Dataset for protein Bik of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F7FUT7_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Callithrix jacchus GN=BIK (length=276 residues).
METPECAPVSGAGKTATHETKQVCRTAGGREAVNKPTGRTCSGSVANAIQTPVQHSALGVREAAPGAGRRGAGPGRGGAS
RSIRSRAGPRAADTTPLGWVADSAIIAATAAAAAAAAARGEMSEVRPLSSDIFMETLLCEQFVDPLTMEVVGGSDPEEDL
DPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLW
RSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
>gnl|bcl2dbpro|F7FUT7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Callithrix jacchus GN=BIK (length=224 residues).
MPQGAVRHYPSPRGRLPPPTPPGTFLIYLSLVGLWGPSQQVCRWAPCPQFSPGPAPLLLSGSPRPEGGEMSEVRPLSSDI
FMETLLCEQFVDPLTMEVVGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFV
LDRTDIGDVLSGVVDVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
© 1998-2020Legal notice