Dataset for protein Bad of organism Callithrix jacchus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U3F2S3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Callithrix jacchus GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHRRQAPGLPGDASHQQGQSTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGR
GGSAPSQ
© 1998-2020Legal notice