Dataset for protein Unclassified of organism Caenorhabditis japonica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2H2JHB0_uncEGL1-01 Putative Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis japonica (length=51 residues).
XDDSDAVQTGREIGARIATMCDEFDAELMSFANYPAKDRGLLARVLDFFAF
© 1998-2022Legal notice