Dataset for protein Noxa of organism Buteo japonicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0HKC1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Buteo japonicus GN=PMAIP1 (length=43 residues).
PPASSSSAPVEAQCALQLRRIGDKWDLRQKILNLLTKLFFPET
© 1998-2022Legal notice