Dataset for protein Bmf of organism Buteo japonicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0AW70_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Buteo japonicus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
© 1998-2022Legal notice