Dataset for protein Bim of organism Buteo japonicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0B3C7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Buteo japonicus GN=BCL2L11 (length=183 residues).
MLLRGELSRFPPTDGKSFSLLEAGFLGVQIQLWLSSQYDKTDRFPFSCCALQNGLGRKCENVIKLSRQRFFKVREGAAAV
PARKEGYLERGKEKVLLGKESGAWHLSFPPYLIGDQTSRWQSHSLAEDVQPEIWIAQELRRIGDEFNASYCPRRGFLDNQ
AGNPQIIILRLLRYIIRLIWRMQ
© 1998-2022Legal notice