Dataset for protein Bim of organism Bubo bubo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0FLD7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bubo bubo GN=BCL2L11 (length=104 residues).
MHILRDKSHLCCIPCAGPEYLFFCCCSSVSTALVLFRAASRWQSHSLAEDVQPEIWIAQELRRIGDEFNASYCPRRVTFI
FLLSISLHRGPLPAPASHLLLQRP
© 1998-2022Legal notice