Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A3Q1LXZ6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Bos taurus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A3Q1MV27_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Bos taurus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|A0A3Q1MV27_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bos taurus GN=BCL2L11 (length=171 residues).
MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPM
SCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVL
RYIVRLVWRMQ
>gnl|bcl2dbpro|A0A3Q1NFP6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Bos taurus GN=PMAIP1 (length=54 residues).
MPGRRARKSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|F1MUT9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos taurus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGP
EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
>gnl|bcl2dbpro|Q05KI3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Bos taurus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|Q05KI3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Bos taurus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|Q3SYZ0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos taurus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSRADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGP
EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATEMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
© 1998-2020Legal notice