Dataset for protein Bim of organism Bos mutus grunniens

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9YZT6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQYRGGDC
ACVGA
© 1998-2022Legal notice