Dataset for protein Bad of organism Bos mutus grunniens

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0AME3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos mutus grunniens GN=BAD (length=115 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGQAPGLSKHWLTAPGLLGKLVTSRGSRPAAATMEALGLWRPGVVTAPTPQGQR
IMKRRRRRISAFRGRSRSAPPTSGLHSDMAASSGG
© 1998-2022Legal notice