Dataset for protein Bim of organism Balaenoptera musculus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8B8Z6B1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8B8Z6B1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
>gnl|bcl2dbpro|A0A8B8Z6B1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
>gnl|bcl2dbpro|A0A8B8Z6B1_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLT
ECLAAYT
© 1998-2022Legal notice