Dataset for protein Puma of organism Balaenoptera musculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0I683_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Balaenoptera musculus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2022Legal notice