Dataset for protein Bad of organism Balaenoptera musculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B8Y772_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Balaenoptera musculus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKHPQTAPGLLGEAGHQQGQPASSSHHGGTGAVETRSRHSFYSAGT
EDEEGTEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHGSFKGLPRPKSAGTATQMRQSPSWARFLQSWWNRNLG
RGGPAPSQ
© 1998-2022Legal notice