Dataset for protein Bmf of organism Athene cunicularia

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A663MPI8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Athene cunicularia GN=BMF (length=211 residues).
MLLSCLSCFLKCPFIAGAMDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTH
CCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPREGQREARAEVQI
ARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
© 1998-2020Legal notice