Dataset for protein Bim of organism Athene cunicularia

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A663MLZ1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Athene cunicularia GN=BCL2L11 (length=66 residues).
GSQAAPFSSKDVQPEIWIAQELRRIGDEFNASYCPRRVTFIFLLSISLHMASKREKLNHLWKLVLR
© 1998-2020Legal notice