Dataset for protein Bmf of organism Aquila chrysaetos chrysaetos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A663DZQ4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEVNRNHTGQR
© 1998-2020Legal notice