Dataset for protein Bim of organism Apteryx owenii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9QMZ1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Apteryx owenii GN=BCL2L11 (length=217 residues).
MGPARGRRPRPPRSPPPAPPPPLSLSPRRRPGAPMAKQAADVNSPCEREGGRLQAPRRPGHPRPGAPTSLPWGEGDPASP
SPPVAPPTSPSPFATRSPLFIFVRRSSLLSRSSSGYFSFDADRSPAPMSCDKATQTPSPPCQAFNHYLSAMASRWRSHSL
AEDIQPEIWIAQELRRIGDEFNASYCPRRVIFRFFFSISFCAVSKREKRNHIWKRVL
© 1998-2022Legal notice