Dataset for protein Noxa of organism Anolis carolinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A803TSK5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anolis carolinensis GN=PMAIP1 (length=46 residues).
MPGLESHKSEVAAECALQLRVIGDKWNLRQRILNMISKIFCPGRGE
© 1998-2022Legal notice