Dataset for protein Bim of organism Anolis carolinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A803SRF0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anolis carolinensis GN=BCL2L11 (length=64 residues).
MQPEIWIAQELRRIGDEFNASHCPRRVKHFLKKIICCNPILKLCMQRKVHIRMVYHAFIKLSPR
© 1998-2022Legal notice