Dataset for protein Noxa of organism Anas platyrhynchos platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A493SWX7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=PMAIP1 (length=51 residues).
MPCRTLRKPAQPSAERQAVAECALELRRIGDKADFRQRILNLITKLFCPKT
© 1998-2020Legal notice