Dataset for protein Bim of organism Anas platyrhynchos platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U3IW89_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BCL2L11 (length=159 residues).
GGAGKHGAGTGRDGRGGQRQPRARSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLA
EEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHLVPRLPPPFPRPGSVAGGVCLVGAVQLGIKVTFFTLFSF
© 1998-2020Legal notice