Dataset for protein Bik of organism Ailuropoda melanoleuca

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A7N5KDU2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BIK (length=281 residues).
MGMEKSTVASGLLGGRMGQSCQDPGSYTQIQPLDSSTSTPWRLLNAPPCWETALADGGAQTAHTFTQPPRTRGRGSGAAG
RERRPRGRAGAGPAVYKLARRPEAADNTAPGSSAPAATIAATAAATSDAREEMSHTGPLSRNLFLSTFLQEHGPEVLEVP
GMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSLVDGLTNLREN
VRIWSFLTFRNRVSPHPGRGLVLSLLLLLGLLLGWGFRLLQ
© 1998-2022Legal notice