Dataset for protein 097R of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

32 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I2BFW4_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEDVH
Q6YH32_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVH
A0A0U2QBA9_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGINLEEVH
A0A0U2QHX4_097R-01      MDVRQFLLDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVH
A0A0U2R7T3_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVH
D3TTY2_097R-01          MGVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
Q2WEP2_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVH
A0A3Q9T2R6_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTMHWEGVNLEEVH
H9XFR8_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVSLEEVH
H6WEE3_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A220IH18_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A1B2ITU5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A0D3R3I2_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGIDNRACAHLYTMLWEGVNLEEVH
Q6GZM8_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
W8TMV3_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A223PJ87_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2P1GJP0_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
C3RWV2_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2U9QGY4_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2U9QHH2_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A3Q9T8U5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMQWEGVNLEEVH
A0A2D0XMC5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A222NTN8_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A0D3R3S5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
T2C510_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
V5N073_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A223PJJ8_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACTHLYTMLWEGVNLEEVH
A0A222NTZ1_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A3Q8UH03_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNKACAHLYTMLWEGVNLEEVH
A0A192GQ13_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNKACAHLYTMLWEGVNLEEVH
A0A0A0VDG1_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2D0XKG8_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
                        *.***** *******************:** * :***** ***:.**:**

I2BFW4_097R-01          ASLLGDGVVNWGRVAAFMHVCRYTVRTFPSSMDRTEVALTKFIQDPRVDK
Q6YH32_097R-01          ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A0U2QBA9_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A0U2QHX4_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A0U2R7T3_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
D3TTY2_097R-01          ASLLGDGIVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIDE
Q2WEP2_097R-01          ASLLRDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A3Q9T2R6_097R-01      ASLLGDGVVNWGRVAVFMHVCRYTVRTFPSSMDRTEVALTKFIQDPKIYK
H9XFR8_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
H6WEE3_097R-01          ASLLGDGVVNWGRMAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A220IH18_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A1B2ITU5_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A0D3R3I2_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
Q6GZM8_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
W8TMV3_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A223PJ87_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2P1GJP0_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
C3RWV2_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2U9QGY4_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2U9QHH2_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A3Q9T8U5_097R-01      ASLLGDGVVNWGRVAVFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A2D0XMC5_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A222NTN8_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A0D3R3S5_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
T2C510_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
V5N073_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A223PJJ8_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A222NTZ1_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A3Q8UH03_097R-01      ASLLGDGVVNWGRVAVFMHICRYIVRIFPSSMDRTEVALTKFIQDPKIDK
A0A192GQ13_097R-01      ASLLGDGVVNWGRVAVFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A0A0VDG1_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2D0XKG8_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
                        **:* **:*****:*.***:*** ** *******************.: :

I2BFW4_097R-01          HLREWTDRLGTVGVIGRCLEWLEREWLGVGVITGVI----TGVV------
Q6YH32_097R-01          HLREWTDRLGTVGVIGRCL-----KWLGA----GVI----TGVV------
A0A0U2QBA9_097R-01      HLREWTDRLGTVGVIGRCL-----KWLGA----GVI----TGVV------
A0A0U2QHX4_097R-01      HLREWTDRLGTVGVIGRCL-----KWLGA----GVI----TGVV------
A0A0U2R7T3_097R-01      HLREWTDRLGTVGVIGRCL-----KWLGA----GVI----TGVV------
D3TTY2_097R-01          HLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
Q2WEP2_097R-01          QLREWTDRLGTVGVIGKCL-----EWLGAGVITGVITGVITGVITGVI--
A0A3Q9T2R6_097R-01      HLREWTDRLGTVGVIGRCL-----EWLGAGVITGVI----TGVVLSLLSL
H9XFR8_097R-01          QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
H6WEE3_097R-01          QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
A0A220IH18_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
A0A1B2ITU5_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
A0A0D3R3I2_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGV----GVI----TGVV------
Q6GZM8_097R-01          QLREWTDRLGTVGLIGRCL-----EWLGA----GVI----TGVV------
W8TMV3_097R-01          QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
A0A223PJ87_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
A0A2P1GJP0_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
C3RWV2_097R-01          QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
A0A2U9QGY4_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
A0A2U9QHH2_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GVI----TGVV------
A0A3Q9T8U5_097R-01      HLREWTDRLGTVGVIGRCL-----EWLGAGVITGVI----TGVV------
A0A2D0XMC5_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGAGVITGVI----TGVV------
A0A222NTN8_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGAGVITGVI----TGVV------
A0A0D3R3S5_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGAGVITGVI----TGVV------
T2C510_097R-01          QLREWTDRLGTVRVIGRCL-----EWLGA----GVI----TGVV------
V5N073_097R-01          QLREWTDRLGTVRVIGRCL-----EWLGA----GVI----TGVV------
A0A223PJJ8_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGA----GVI----TGVV------
A0A222NTZ1_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGA----GVI----TGVV------
A0A3Q8UH03_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGAGAIAGVI----AGVV------
A0A192GQ13_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGAGAIAGVI----AGVV------
A0A0A0VDG1_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGAGVITGVITGVITGVV------
A0A2D0XKG8_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGAGVITGVI----TGVV------
                        :*********** :**.**     :***.    ***    :**:      

I2BFW4_097R-01          LSLLFS
Q6YH32_097R-01          LSLLFS
A0A0U2QBA9_097R-01      LSLLFS
A0A0U2QHX4_097R-01      LSLLFS
A0A0U2R7T3_097R-01      LSLLFS
D3TTY2_097R-01          LSLLFS
Q2WEP2_097R-01          LSLLFS
A0A3Q9T2R6_097R-01      LSLLFS
H9XFR8_097R-01          LSLLFY
H6WEE3_097R-01          LSLLFS
A0A220IH18_097R-01      LSLLFS
A0A1B2ITU5_097R-01      LSLLFS
A0A0D3R3I2_097R-01      LSLLFS
Q6GZM8_097R-01          LSLLFY
W8TMV3_097R-01          LSLLFY
A0A223PJ87_097R-01      LSLLFY
A0A2P1GJP0_097R-01      LSLLFY
C3RWV2_097R-01          LSLLFY
A0A2U9QGY4_097R-01      LSLLFY
A0A2U9QHH2_097R-01      LSLLFY
A0A3Q9T8U5_097R-01      LSLLFS
A0A2D0XMC5_097R-01      LSLLFS
A0A222NTN8_097R-01      LSLLFS
A0A0D3R3S5_097R-01      LSLLFS
T2C510_097R-01          LSLLFS
V5N073_097R-01          LSLLFS
A0A223PJJ8_097R-01      LSLLFS
A0A222NTZ1_097R-01      LSLLFS
A0A3Q8UH03_097R-01      LSLLFS
A0A192GQ13_097R-01      LSLLFS
A0A0A0VDG1_097R-01      LSLLFS
A0A2D0XKG8_097R-01      LSLLFS
                        ***** 

© 1998-2020Legal notice