Dataset for protein M11 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P89884_M11-01          MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRR
B1PZP0_M11-01          MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRR
A0A6M4EIA3_M11-01      MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRR
D0U1R1_M11-01          MSHKRTGTYWATIITAFLKSVSKVEELDCYDSDVLDDVSKIITLTQEFRS
                       ****.:******:******:********* ** ** ************* 

P89884_M11-01          HYDSVYRADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCE
B1PZP0_M11-01          HYDSVYRADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCE
A0A6M4EIA3_M11-01      HYDSVYRADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCE
D0U1R1_M11-01          HYDSVFHMDYGPALQNWKGGLARLFTSLFGDAINRGRIVGFFDVGRYVCE
                       *****:. ******:*** .*:.****** *.** ***************

P89884_M11-01          EVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFT
B1PZP0_M11-01          EVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFT
A0A6M4EIA3_M11-01      EVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFT
D0U1R1_M11-01          ELLCPGSWTEEHDLLNEYMTQFFIENNLMNYFSLEDTFCTQTKFHNMGFS
                       *:********:*:***: **:*********:*.*** * :* **:. **:

P89884_M11-01          FLLHALAKVLPRIYSGNVIYV
B1PZP0_M11-01          FLLHALAKVLPRIYSGNVIYV
A0A6M4EIA3_M11-01      FLLHALAKVLPRIYSGNVIYV
D0U1R1_M11-01          LALSILCRALTRIYSGDVIYV
                       : *  *...*.*****:****

© 1998-2022Legal notice