Dataset for protein E1B 19K of organism Simian adenovirus 3

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q695T5_E1B19K-01      --------MDLYESLENLSSLRRLLEEASDRTSYI---------------
Q695T5_E1B19K-02      MERADAAQPGLYSGLPDAMPMEVRNQEGEEAVRALGGEASVSAPAASASS
                               .**..* :  .:    :*..: .  :               

Q695T5_E1B19K-01      -----------------------------------------WRFLFGSPL
Q695T5_E1B19K-02      SAAEAGGSGSHFGGGERHGREESESGAGPSGGGVGGIPDPFPELALGAVG
                                                                 : :*:  

Q695T5_E1B19K-01      SRFLYR---------VKREHLTEFDGLLEQ--------------LPGLFD
Q695T5_E1B19K-02      GASVVREDEEGRQRGQKREHFESSTFLADVTVALMAKNRLEVVWYPEVWE
                      .  : *          ****: .   * :                * :::

Q695T5_E1B19K-01      SLNLGHRTLLEERLFPQLD-------------------------------
Q695T5_E1B19K-02      DFEKGDLHLLEKYNFEQVKTYWMNPDEDWEVVLNRYGKVALRPDCRYQVR
                      .:: *   ***:  * *:.                               

Q695T5_E1B19K-01      --------------------------------------------------
Q695T5_E1B19K-02      DKVVLRRNVYLLGNGATVEMVDPRRGGFVANMQEMCPGVVGLSGVTFHSV
                                                                        

Q695T5_E1B19K-01      --------------------------------------------------
Q695T5_E1B19K-02      RFSGSNFGGVVITANTPVVLHNCYFFGFSNTCVEMRVGGKVRGCSFYACW
                                                                        

Q695T5_E1B19K-01      ----------------------------------------------FSSP
Q695T5_E1B19K-02      KGVVSQGKAKVSVHKCMLERCTLGISSEGFLHAGDNVASDNGCAFLIKGG
                                                                    :.. 

Q695T5_E1B19K-01      GRLCSALA----------------------------FAVHLLDRWNEQTQ
Q695T5_E1B19K-02      GRICHNMICGPGDVPPKPYQMVTCTDGKVRMLKPVHIVGHRRHRW-----
                      **:*  :                             :. *   **     

Q695T5_E1B19K-01      LSPGYTLDFLTLCLWKFGIRRG----------------------RKLYGR
Q695T5_E1B19K-02      --PEFEHNVMTRCSLYLGGRRGVFMPRQCNLAHCNVIMEQSAATQVCFGG
                        * :  :.:* *   :* ***                      .  :* 

Q695T5_E1B19K-01      LVE---------RHPSLRQQR------------------LQAQVLLRRED
Q695T5_E1B19K-02      IFDISMVVYKILRYDDCRARTRTCDCGASHLCNLTVMGMVTEEVRLDHCQ
                      :.:         *: . * .                   :  :* * . :

Q695T5_E1B19K-01      LEAISEEESGMEEKNPRAGLDPPAEE
Q695T5_E1B19K-02      HSCLREEFSSSDEED-----------
                       ..: ** *. :*::           

© 1998-2020Legal notice