Dataset for protein adenoviridae of organism Human mastadenovirus E

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6H1D7_E1B19K-02        MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSEDPESP
A0A2R3WN16_E1B19K-      MEIWTVLED-----------------------------------------
Q6H1D7_E1B19K-01        MEIWTVLED-----------------------------------------
A0A2R3WN62_E1B19K-      MEIWTVLED-----------------------------------------
A0A2L1F392_E1B19K-      MEIWTVLED-----------------------------------------
A0A2R3WNP3_E1B19K-      MEIWTVLED-----------------------------------------
                        ** .. :::                                         

Q6H1D7_E1B19K-02        AAGGSRRESESRPGPSGGGVADLFPELHRVLTRSSSGRERGIKRERHDET
A0A2R3WN16_E1B19K-      -----------------------FYKTRQLLENASNG-------------
Q6H1D7_E1B19K-01        -----------------------FHKTRQLLENASNG-------------
A0A2R3WN62_E1B19K-      -----------------------FHKTRQLLENASNG-------------
A0A2L1F392_E1B19K-      -----------------------FYKTRQLLENASNG-------------
A0A2R3WNP3_E1B19K-      -----------------------FYKTRQLLENASNG-------------
                                               * : ..:* .:*.*             

Q6H1D7_E1B19K-02        NHRIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQVKTCWLE
A0A2R3WN16_E1B19K-      ---------------VSYLW-----------------RFCFGG-------
Q6H1D7_E1B19K-01        ---------------VSYLW-----------------RFCFGG-------
A0A2R3WN62_E1B19K-      ---------------VSYLW-----------------RFCFGG-------
A0A2L1F392_E1B19K-      ---------------VSYLW-----------------RFCFGG-------
A0A2R3WNP3_E1B19K-      ---------------VSYLW-----------------RFCFGG-------
                                        . :*                 **.:         

Q6H1D7_E1B19K-02        PEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICLQD
A0A2R3WN16_E1B19K-      ----------DLAKLVYRTKQDYK-EQFDDILKEC---------------
Q6H1D7_E1B19K-01        ----------DLAKLVYRAKQDYR-EQFEDILREC---------------
A0A2R3WN62_E1B19K-      ----------DLAKLVYRAKQDYR-EQFEDILREC---------------
A0A2L1F392_E1B19K-      ----------DLAKLVYRTKQDYK-EQFDDILKEC---------------
A0A2R3WNP3_E1B19K-      ----------DLAKLVYRTKQDYK-EQFDDILKEC---------------
                                  : ***. *....*.  :: :* . *               

Q6H1D7_E1B19K-02        RVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTVFMANTKLTVHGCS
A0A2R3WN16_E1B19K-      ------------PG------------------------------------
Q6H1D7_E1B19K-01        ------------PG------------------------------------
A0A2R3WN62_E1B19K-      ------------PG------------------------------------
A0A2L1F392_E1B19K-      ------------PG------------------------------------
A0A2R3WNP3_E1B19K-      ------------PG------------------------------------
                                    **                                    

Q6H1D7_E1B19K-02        FFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSMLSVKKCLFERCHLG
A0A2R3WN16_E1B19K-      ------------------------------------------LFDALNLG
Q6H1D7_E1B19K-01        ------------------------------------------LFDALNLG
A0A2R3WN62_E1B19K-      ------------------------------------------LFDALNLG
A0A2L1F392_E1B19K-      ------------------------------------------LFDALNLG
A0A2R3WNP3_E1B19K-      ------------------------------------------LFDALNLG
                                                                  **:  :**

Q6H1D7_E1B19K-02        VMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAG
A0A2R3WN16_E1B19K-      HQSHFNQRISRALDFTT---------------------------------
Q6H1D7_E1B19K-01        HQSHFNQRISRALDFTT---------------------------------
A0A2R3WN62_E1B19K-      HQSHFNQRISRALDFTT---------------------------------
A0A2L1F392_E1B19K-      HQSHFNQRISRALDFTT---------------------------------
A0A2R3WNP3_E1B19K-      HQSHFNQRISRALDFTT---------------------------------
                          *  : ** .. .  *                                 

Q6H1D7_E1B19K-02        GNSHMLAAVHVASHSRKPWPEFEHNVMTRCNMHLGARRGMFMPYQCNLNY
A0A2R3WN16_E1B19K-      -PGRTTAAVAFFAFVLDKWSQETH-----------------FSRDYQLDF
Q6H1D7_E1B19K-01        -PGRTTAAVAFFAFIFDKWSQETH-----------------FSRDYQLDF
A0A2R3WN62_E1B19K-      -PGRTTAAVAFFAFIFDKWSQETH-----------------FSRDYQLDF
A0A2L1F392_E1B19K-      -PGRTTAAVAFFAFVLDKWSQETH-----------------FSRDYQLDF
A0A2R3WNP3_E1B19K-      -PGRTTAAVAFFAFVLDKWSQETH-----------------FSRDYQLDF
                          ..  *** . :.  . *.:  *                 :. : :*::

Q6H1D7_E1B19K-02        VKVLLEPDVMSRVSLTGVFDMNVEVWKILRYDEYKTRCRACE-CGGKHAR
A0A2R3WN16_E1B19K-      LAVAL-----------------WRAWKCQRLNAISGYLPVQPLDTLRILS
Q6H1D7_E1B19K-01        LAVAL-----------------WRTWKCQRLNAISGYLPVQPLDTLRILS
A0A2R3WN62_E1B19K-      LAVAL-----------------WRTWKCQRLNAIPATCRYSR--------
A0A2L1F392_E1B19K-      LAVAL-----------------WRAWKCQRLNAI---CRYSR--------
A0A2R3WNP3_E1B19K-      LAVAL-----------------WRAWKCQRLNAIPATCRYSR--------
                        : * *                   .**  * :                  

Q6H1D7_E1B19K-02        FQPVCVDVTEDLRPDHLVLSCTGTEFGSSGEESD
A0A2R3WN16_E1B19K-      LQQISQERQRRQQQQEDQEENPRAGLDPPAEEEE
Q6H1D7_E1B19K-01        L-----------QQQEDQEENPRAGLDPPAEE--
A0A2R3WN62_E1B19K-      ----------------------------------
A0A2L1F392_E1B19K-      ----------------------------------
A0A2R3WNP3_E1B19K-      ----------------------------------
                                                          

© 1998-2022Legal notice