Dataset for protein E1B 19K of organism Human mastadenovirus B

[Download (right click)] [Edit] [Sequences] [Repertoires]

31 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


T1UE63_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
T1UIP3_E1B19K-02        MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
J7ID56_E1B19K-02        MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
I6LEP5_E1B19K-02        MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
I6LES1_E1B19K-02        MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
J7I6Q4_E1B19K-02        MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASRSSRDTETP
J7I6S4_E1B19K-02        MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETP
T1UF50_E1B19K-02        MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
J7I6W7_E1B19K-02        MDPADSFQQGIRFGFRSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEAS
T1UJX4_E1B19K-02        MDPADSFQQGIRFGFHSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEAS
T1UE63_E1B19K-02        MDPADSFQQGIRFGFHSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEAS
T1UFS4_E1B19K-02        MDPADSFQQGIRFGFRSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEAS
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        MDPTDPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASTASGRSRDPETP
                                                                          

T1UE63_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
T1UIP3_E1B19K-02        TGHASGSGGGAAGGQSESRPGPS---GGGVADLFPELRRVLTRSTSSGQD
J7ID56_E1B19K-02        TDHASGSAGGAAGGQSESRPGPS---GGGVADLFPELRRVLTRSTTSGQN
I6LEP5_E1B19K-02        TDHASGSAGGAAGGQSESRPGPS---GGGVADLFPELRRVLTRSTTSGQN
I6LES1_E1B19K-02        TDHASGSAGGAAGGQSESRPGPS---GGGVADLFPELRRVLTRSTTSGQN
J7I6Q4_E1B19K-02        TDHASGSAGGAAGGQSESRPGPS---GGGVADLFPELRRVLTRSTTSGQN
J7I6S4_E1B19K-02        TDHASGSAGGAAGGQSESRPGPS---GGGVADLFPELRRVLTRSTTSGQN
T1UF50_E1B19K-02        TDHASGSAGGAAGGQSESRPGPS---GGGVADLFPELRRVLTRSTTSGQN
J7I6W7_E1B19K-02        TGHASGSGGGTARGQPESRPGPS-SGGGGVADLSPELQRVLTGSTSTGRD
T1UJX4_E1B19K-02        TCHASGSGGGTARGQSESRPGPS-SGGGGVADLSPELQRVLTGSTSTGRD
T1UE63_E1B19K-02        TGHASGSGGGTARGQPESRPGPS-SGGGGVADLSPELQRVLTGSTSTGRD
T1UFS4_E1B19K-02        TGHASGSGGGTARGQPESRPGPS-SGGGGVADLSPELQRVLTGSTSTGRD
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        TDHASGFGGGAPRGQSESRPGPSGGGGGGVADLFPELRRVLTRSTTSGRD
                                                                          

T1UE63_E1B19K-01        -----------------------------MEVWAILEDLRKTRQLLESAS
Q5UW22_E1B19K-01        -----------------------------MEVWAILEDLRKTRQLLENAS
A0A1L7NRH1_E1B19K-      -----------------------------MEVWAILEDLRKTRQLLEDAS
T1UFS4_E1B19K-01        -----------------------------MEVWAILEDLRKTRQLLEDAS
J7I6W7_E1B19K-01        -----------------------------MEVWAILEDLRKTRQLLENAS
T1UJX4_E1B19K-01        -----------------------------MEVWAILEDLRKTRQLLENAS
T2CI10_E1B19K-01        -----------------------------MEVWAILEDLRQTRQLLENAS
A0A0K0PX35_E1B19K-      -----------------------------MEVWAILEDLRQTRLLLENAS
A0A0K0PX99_E1B19K-      -----------------------------MEVWAILEDLRQTRLLLENAS
T1UIP3_E1B19K-01        -----------------------------MEVWAILEDLRQTRLLLENAS
J7ID56_E1B19K-01        -----------------------------MEVWAILEDLKQTRLLLENAS
J7I6Q4_E1B19K-01        -----------------------------MEVWAILEDLRQTRLLLENAS
J7I6S4_E1B19K-01        -----------------------------MEVWAILEDLRQTRLLLENAS
A0A6M6AA96_E1B19K-      -----------------------------MEVWAILEDLRQTRLLIENAS
I6LEP5_E1B19K-01        -----------------------------MEVWAILEDLRQTRLLLENAS
I6LES1_E1B19K-01        -----------------------------MEVWAILEDLRQTRLLLENAS
T1UF50_E1B19K-01        -----------------------------MKVWAILEDLRQTRLLLENAS
T1UIP3_E1B19K-02        RGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEK
J7ID56_E1B19K-02        RGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEK
I6LEP5_E1B19K-02        RGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEK
I6LES1_E1B19K-02        RGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEK
J7I6Q4_E1B19K-02        RGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEK
J7I6S4_E1B19K-02        RGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEK
T1UF50_E1B19K-02        RGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEK
J7I6W7_E1B19K-02        RGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEK
T1UJX4_E1B19K-02        RGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEK
T1UE63_E1B19K-02        RGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEK
T1UFS4_E1B19K-02        RGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEK
I6LEP5_E1B19K-03        ----------------------MSRRRPETVWWHEVQSEGRDEVSILQEK
I6LES1_E1B19K-03        ----------------------MSRRRPETVWWHEVQSEGRDEVSILQEK
T2CI10_E1B19K-02        RGIKRERNPSGTNPRSELALSLMSRRRPETIWWHEVQNEGRDEVSILQEK
                                                        *  ::.  .    : . .

T1UE63_E1B19K-01        DGVSGFWRFWFASE---------LARVVFRIKQDYKQEFEKLLVDC----
Q5UW22_E1B19K-01        DGVSGFWRFWFASE---------LARVVFRIKQDYKQEFEKLLVDC----
A0A1L7NRH1_E1B19K-      DGVSGFWRFWFASE---------LARVVFRIKQDYKEEFEKLLLDC----
T1UFS4_E1B19K-01        DGVSGFWRFWFASE---------LARVVFRIKQDYKEEFEKLLVDC----
J7I6W7_E1B19K-01        DGVSGFWRFWFASE---------LARVVFRIKQDYKEEFEKLLVDC----
T1UJX4_E1B19K-01        DGVSGFWRFWFASE---------LARVVFRIKQDYKEEFEKLLVDC----
T2CI10_E1B19K-01        DGVSGLWRFWFGGD---------LARLVFRIKQDYRQEFEKLLDDC----
A0A0K0PX35_E1B19K-      DGVSGLWRFWFGGD---------LARLVFRIKQDYREEFEKLLDDS----
A0A0K0PX99_E1B19K-      DGVSGLWRFWFGGD---------LARLVFRIKQDYREEFEKLLDDS----
T1UIP3_E1B19K-01        DGVSGFWRFWFGGD---------LARLVFRIKQDYREEFEKLLDDS----
J7ID56_E1B19K-01        DGVSGLWRFWFGGD---------LARLVFRIKQDYREEFEKLLDDS----
J7I6Q4_E1B19K-01        DGVSGLWRFWFGGD---------LARLVFRIKQDYSVEFEKLLDDS----
J7I6S4_E1B19K-01        DGVSGLWRFWFGGD---------LARLVFRIKQDYSVEFEKLLDDS----
A0A6M6AA96_E1B19K-      DGVSGLWRFWFGGD---------LARLVFRIKQDYREEFEKLLDDS----
I6LEP5_E1B19K-01        DGVSGLWRFWFGGD---------LARLVFRIKQDYREEFEKLLDDS----
I6LES1_E1B19K-01        DGVSGLWRFWFGGD---------LARLVFRIKQDYREEFEKLLDDS----
T1UF50_E1B19K-01        DGVSGLWRFWFGGD---------LARLVFRIKQDYREEFEKLLDDS----
T1UIP3_E1B19K-02        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
J7ID56_E1B19K-02        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
I6LEP5_E1B19K-02        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
I6LES1_E1B19K-02        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
J7I6Q4_E1B19K-02        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
J7I6S4_E1B19K-02        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
T1UF50_E1B19K-02        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
J7I6W7_E1B19K-02        YSLEQVKTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYIS
T1UJX4_E1B19K-02        YSLEQVKTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYIS
T1UE63_E1B19K-02        YSLEQVKTCWLEPEDDWEVAIKNYAKIALRPDKQYKISRRINIRNACYIS
T1UFS4_E1B19K-02        YSLEQVKTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYIS
I6LEP5_E1B19K-03        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
I6LES1_E1B19K-03        YSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYIS
T2CI10_E1B19K-02        YSLEQVKTCWLEPEDDWEVAIRNYAKIALRPDKLYRITKRINIRNACYIS
                         .:. ..  *:  :          *.: :* .: *       : :.    

T1UE63_E1B19K-01        -PGLFEALNLGHQVHFK------------EKVLSVLDFSTPGRTAAAVAF
Q5UW22_E1B19K-01        -PGLFEALNLGHQVHFK------------EKVLSVLDFSTPGRTAAAVAF
A0A1L7NRH1_E1B19K-      -PGLFEALNLGHQVHFK------------EKVLSVLDFSTPGRTAAAVAF
T1UFS4_E1B19K-01        -PGLFEALNLGHQVHFK------------EKVLSVLDFSTPGRTAAAVAF
J7I6W7_E1B19K-01        -PGLFEALNLGHQVHFK------------EKVLSVLDFSTPGRTAAAVAF
T1UJX4_E1B19K-01        -PGLFEALNLGHQVHFK------------EKVLSVLDFSTPGRTAAAVAF
T2CI10_E1B19K-01        -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
A0A0K0PX35_E1B19K-      -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
A0A0K0PX99_E1B19K-      -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
T1UIP3_E1B19K-01        -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
J7ID56_E1B19K-01        -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
J7I6Q4_E1B19K-01        -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
J7I6S4_E1B19K-01        -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
A0A6M6AA96_E1B19K-      -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
I6LEP5_E1B19K-01        -PGLFEALNLGHRAHFK------------EKVLSVLDFSTPGRTAAAVAF
I6LES1_E1B19K-01        -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
T1UF50_E1B19K-01        -PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAF
T1UIP3_E1B19K-02        GNGAEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVF
J7ID56_E1B19K-02        GNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVF
I6LEP5_E1B19K-02        GNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVF
I6LES1_E1B19K-02        GNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVF
J7I6Q4_E1B19K-02        GNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVF
J7I6S4_E1B19K-02        GNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVF
T1UF50_E1B19K-02        GNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVF
J7I6W7_E1B19K-02        GNGAEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVF
T1UJX4_E1B19K-02        GNGAEVVIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVF
T1UE63_E1B19K-02        GNGAEVVIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVF
T1UFS4_E1B19K-02        GNGAEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVF
I6LEP5_E1B19K-03        GNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVF
I6LES1_E1B19K-03        GNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVF
T2CI10_E1B19K-02        GNGAEVVIDTQDRTVFRCCMMGMWPGVVGMEAVTLMNVKFRGDGYNGVVF
                          *    ::   .. :.             :.::.::.   *    .:.*

T1UE63_E1B19K-01        LT----------------FILDKW----IPQTHFSRGYVLD---------
Q5UW22_E1B19K-01        LT----------------FILDKW----IPQTHFSRGYVLD---------
A0A1L7NRH1_E1B19K-      LT----------------FILDKW----IPQTHFSRGYVLD---------
T1UFS4_E1B19K-01        LT----------------FILDKW----IPQTHFSRGYVLD---------
J7I6W7_E1B19K-01        LT----------------FILDKW----IPQTHFSRGYVLD---------
T1UJX4_E1B19K-01        LT----------------FILDKW----IPQTHFSRGYVLD---------
T2CI10_E1B19K-01        LT----------------FIFDKW----IPQTHFSKGYVLD---------
A0A0K0PX35_E1B19K-      LT----------------FILDKW----IRQTHFSKGYVLD---------
A0A0K0PX99_E1B19K-      LT----------------FILDKW----IRQTHFSRGYVLD---------
T1UIP3_E1B19K-01        LT----------------FILDKW----IRQTHFSKGYVLD---------
J7ID56_E1B19K-01        LT----------------FILDKW----IRQTHFSKGYVLD---------
J7I6Q4_E1B19K-01        LT----------------FILDKW----IRQTHFSKGYVLD---------
J7I6S4_E1B19K-01        LT----------------FILDKW----IRQTHFSKGYVLD---------
A0A6M6AA96_E1B19K-      LT----------------FILDKW----IRQTHFSKGYVLD---------
I6LEP5_E1B19K-01        LT----------------FILDKW----IRQTHFSKGYVLD---------
I6LES1_E1B19K-01        LT----------------FILDKW----IRQTHFSKGYVLD---------
T1UF50_E1B19K-01        LT----------------FILDKW----IRQTHFSKGYVLD---------
T1UIP3_E1B19K-02        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
J7ID56_E1B19K-02        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
I6LEP5_E1B19K-02        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
I6LES1_E1B19K-02        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
J7I6Q4_E1B19K-02        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
J7I6S4_E1B19K-02        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
T1UF50_E1B19K-02        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
J7I6W7_E1B19K-02        MANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLS
T1UJX4_E1B19K-02        MANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLS
T1UE63_E1B19K-02        MANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLS
T1UFS4_E1B19K-02        MANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLS
I6LEP5_E1B19K-03        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
I6LES1_E1B19K-03        MANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLS
T2CI10_E1B19K-02        MANTKLILHGCSFFGFNNICVEAWGQVSVRGCSFYACWIATSGRTKSQLS
                        ::                  .: *    :    *   ::           

T1UE63_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
T1UIP3_E1B19K-02        VKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHS
J7ID56_E1B19K-02        VKKCMFERCNLGILNEGEARVRHCAATQTGCFILIKGNASVKHNMICGHS
I6LEP5_E1B19K-02        VKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHS
I6LES1_E1B19K-02        VKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHS
J7I6Q4_E1B19K-02        VKKCMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHS
J7I6S4_E1B19K-02        VKKCMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHS
T1UF50_E1B19K-02        VKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHS
J7I6W7_E1B19K-02        LKKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGAS
T1UJX4_E1B19K-02        LKKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGAS
T1UE63_E1B19K-02        LKKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGAS
T1UFS4_E1B19K-02        LKKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGAS
I6LEP5_E1B19K-03        VKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHS
I6LES1_E1B19K-03        VKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHS
T2CI10_E1B19K-02        VKKCMFERCNLGILNEGEARVSHCASSETGCFILIKGNANVKHNMICGPS
                                                                          

T1UE63_E1B19K-01        ---------------------FIATALWRTWKV-----------------
Q5UW22_E1B19K-01        ---------------------FIATALWRTWKV-----------------
A0A1L7NRH1_E1B19K-      ---------------------FIATALWRTWKV-----------------
T1UFS4_E1B19K-01        ---------------------FVATALWRTWKV-----------------
J7I6W7_E1B19K-01        ---------------------FVATALWRTWKV-----------------
T1UJX4_E1B19K-01        ---------------------FIATALWRTWKV-----------------
T2CI10_E1B19K-01        ---------------------FIAAALWRTWKA-----------------
A0A0K0PX35_E1B19K-      ---------------------FIAAALWRTWKA-----------------
A0A0K0PX99_E1B19K-      ---------------------FIAAALWRTWKA-----------------
T1UIP3_E1B19K-01        ---------------------FIAAALWRTWKA-----------------
J7ID56_E1B19K-01        ---------------------FIAAALWRTWKA-----------------
J7I6Q4_E1B19K-01        ---------------------FIAAALWRTWKA-----------------
J7I6S4_E1B19K-01        ---------------------FIAAALWRTWKA-----------------
A0A6M6AA96_E1B19K-      ---------------------FIAAALWRTWKA-----------------
I6LEP5_E1B19K-01        ---------------------FIAAALWRTWKA-----------------
I6LES1_E1B19K-01        ---------------------FIAAALWRTWKA-----------------
T1UF50_E1B19K-01        ---------------------FIAAALWRTWKA-----------------
T1UIP3_E1B19K-02        NERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
J7ID56_E1B19K-02        DERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
I6LEP5_E1B19K-02        DERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
I6LES1_E1B19K-02        DERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
J7I6Q4_E1B19K-02        DERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
J7I6S4_E1B19K-02        DERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
T1UF50_E1B19K-02        DERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
J7I6W7_E1B19K-02        DERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRR
T1UJX4_E1B19K-02        DERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRR
T1UE63_E1B19K-02        DERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRR
T1UFS4_E1B19K-02        DERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRR
I6LEP5_E1B19K-03        DERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
I6LES1_E1B19K-03        DERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRR
T2CI10_E1B19K-02        DERPYQMLTCAGGHCNMLATVHIVSHPRKKWPVLEHNVMTKCTMHVGGRR
                                             .:.:  ...* .                 

T1UE63_E1B19K-01        ----------RKMRTILGYWPVQPLGVAGIL-------------------
Q5UW22_E1B19K-01        ----------RKMRTILGYWPVQPLGVAGIL-------------------
A0A1L7NRH1_E1B19K-      ----------RKMRTILGYWPVQPLGVAGIL-------------------
T1UFS4_E1B19K-01        ----------RKMRTILGYWPVQPLGVAGIL-------------------
J7I6W7_E1B19K-01        ----------RKMRTILGYWPVQPLGVAGIL-------------------
T1UJX4_E1B19K-01        ----------RKMRTILGYWPVQPLGVAGIL-------------------
T2CI10_E1B19K-01        ----------RRMRTILDYWPVQPLGVAGIL-------------------
A0A0K0PX35_E1B19K-      ----------RRMRTILDYWPVQPLGVAGIL-------------------
A0A0K0PX99_E1B19K-      ----------RRMRTILDYWPVQPLGVAGIL-------------------
T1UIP3_E1B19K-01        ----------RRMRTILDYWPVQPLGVAGIL-------------------
J7ID56_E1B19K-01        ----------RRMRTILDYWPVQPLGVAGIL-------------------
J7I6Q4_E1B19K-01        ----------RRMRTILDYWPVQPLGVAGIL-------------------
J7I6S4_E1B19K-01        ----------RRMRTILNYWPVQPLGVAGIL-------------------
A0A6M6AA96_E1B19K-      ----------RRMRTILDYWPVQPLGVAGIL-------------------
I6LEP5_E1B19K-01        ----------RRMRTILDYWPVQPLGVAGIL-------------------
I6LES1_E1B19K-01        ----------RRMRTILDYWPVQPLGVAGIL-------------------
T1UF50_E1B19K-01        ----------RRMRTILDYWPVQPLGVAGIL-------------------
T1UIP3_E1B19K-02        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
J7ID56_E1B19K-02        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
I6LEP5_E1B19K-02        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
I6LES1_E1B19K-02        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
J7I6Q4_E1B19K-02        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
J7I6S4_E1B19K-02        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
T1UF50_E1B19K-02        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
J7I6W7_E1B19K-02        GMFMPYQCNMNHVKVLLEPDAFSRMSLTGMFDMNMQIWKILRYDDTRSRV
T1UJX4_E1B19K-02        GMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNTQIWKILRYDDTRSRV
T1UE63_E1B19K-02        GMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNTQIWKILRYDDTRSRV
T1UFS4_E1B19K-02        GMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRYDDTRSRV
I6LEP5_E1B19K-03        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
I6LES1_E1B19K-03        GMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRV
T2CI10_E1B19K-02        GMLMPYQCNMNNVKVMLEPDAFSRMSLTGIFDMNLQIWKILRYDDTKSRV
                                  ..:..:*   ... :.::*::                   

T1UE63_E1B19K-01        ----------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE-
Q5UW22_E1B19K-01        ----------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE-
A0A1L7NRH1_E1B19K-      ----------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE-
T1UFS4_E1B19K-01        ----------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE-
J7I6W7_E1B19K-01        ----------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE-
T1UJX4_E1B19K-01        ----------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE-
T2CI10_E1B19K-01        ----------RHPPTMPAVLEEEHQED----NPRVGLDPPVEEAEE
A0A0K0PX35_E1B19K-      ----------RHPPAMPSVLEEEQQED----NPRAGLDPPVEEAEE
A0A0K0PX99_E1B19K-      ----------RHPPAMPAVLEEEQQED----NPRAGLDPPVEEAEE
T1UIP3_E1B19K-01        ----------RHPPAMPAVLEEEQQED----NPRAGLDPPVEE---
J7ID56_E1B19K-01        ----------RHPPTMPAVLQEEQQED----NPRAGLDPPVEE---
J7I6Q4_E1B19K-01        ----------RHPPTMPAVLQEEQQED----NPRAGLDPPVEE---
J7I6S4_E1B19K-01        ----------RHPPTMPAVLQEEQQED----NPRAGLDPPVEE---
A0A6M6AA96_E1B19K-      ----------RHPPTMPAVLQEEQQED----NPRAGLDPPVEE---
I6LEP5_E1B19K-01        ----------RHPPTMPAVLQEEQQED----NPRAGLDPPVEE---
I6LES1_E1B19K-01        ----------RHPPTMPAVLQEEQQED----NPRAGLDPPVEE---
T1UF50_E1B19K-01        ----------RHPPTMPAVLQEEQQED----NPRAGLDPPVEE---
T1UIP3_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
J7ID56_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
I6LEP5_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
I6LES1_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
J7I6Q4_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
J7I6S4_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
T1UF50_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
J7I6W7_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVIARTGAEFGSSGEETD-
T1UJX4_E1B19K-02        RTCECGGKHARFQPVCVDVTEDLRPDHLVIARTGAEFGSSGEETD-
T1UE63_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVIARTGAEFGSSGEETD-
T1UFS4_E1B19K-02        RACECGGKHARFQPVCVDVTEDLRPDHLVIARTGAEFGSSGEETD-
I6LEP5_E1B19K-03        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
I6LES1_E1B19K-03        RACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD-
T2CI10_E1B19K-02        RACECGGKHARFQPVCVDVTEELRPDHLVIACTGAEFGSSGEETD-
                                  *. *.   * :: . :      . . :... **   

© 1998-2022Legal notice