Dataset for protein E1B 19K of organism Human mastadenovirus A

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


T1UEX7_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02      MEREVPPELGLHAGLHGNAFVEGMAEEEGLHLLAGAASNHAAVAGGAAEH
                                                                        

T1UEX7_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02      YDGGVNMEPQVQEGHEPDPDEGPSCAVVKKRERKESLKETVLNRLTVNLM
                                                                        

T1UEX7_E1B19K-01      -----------------------------------------MELEAVLQS
T1UEX7_E1B19K-02      SRPRLETVYWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLECAIKA
                                                                :**..:::

T1UEX7_E1B19K-01      FQSVRQLLQYTSKNT-----------------------------------
T1UEX7_E1B19K-02      FAKVALRPDCTYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCRMQGM
                      * .*    : * * :                                   

T1UEX7_E1B19K-01      -------------------SGFWRYLFGSTLSKVVHRVKEDYREEFENIL
T1UEX7_E1B19K-02      GPGVVGLDGITFMNVRFAGEKFKGIMFEANTSVVLHGV---YFLNFNNTC
                                         . *.  :* :. * *:* *   *  :*:*  

T1UEX7_E1B19K-01      ADCPGLLASLDLCHHSVFQERVVRSLDFSSSGRTVASIAFLATVLD----
T1UEX7_E1B19K-02      VECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKCVLALIVEGDAH
                      .:* . ::: .  .:. ::  * *. .  *  . : . ..** :::    

T1UEX7_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02      IRHNAASENTCFILLKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKT
                                                                        

T1UEX7_E1B19K-01      -KWSERSHLSWD------YMLDYMAMHLWRAWLKRRVCIYSLAR------
T1UEX7_E1B19K-02      VHIVSHARYCWPVCDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVMLEPE
                       :  ..:. .*       :*   : : *.*. :.   * :* :.      

T1UEX7_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02      AFSRVSLNGVFDLSVELCKIIRYDDAARHRCRQCECGSSHLELRPVMLNV
                                                                        

T1UEX7_E1B19K-01      -------PLTMPPLQEEQQNTTTEE
T1UEX7_E1B19K-02      TEELRSDHLTLSCLRTDYESSDEDN
                              **:. *. : :.:  ::

© 1998-2020Legal notice