Dataset for protein E1B 19K of organism Human adenovirus D serotype 8

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1P7YWR9_E1B19K-      MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQ
A0A1P7YWY2_E1B19K-      MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQ
A0A1P7YXN8_E1B19K-      MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQ
A0A1P8C849_E1B19K-      MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQ
A0A1P7YYY5_E1B19K-      MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQ
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
                                                                          

A0A1P7YWR9_E1B19K-      TNIHVGGRNEGGHGQEPEERPGPSVGRGAGLNEVSSLYPELSKVLTSMAR
A0A1P7YWY2_E1B19K-      TNIHVGGRNEGVHGQEPEERPGPSVGRGAGLNEVSSLYPELSKVLTSMAR
A0A1P7YXN8_E1B19K-      TNIHVGGRNEGGHGQEPEERPGPSVGRGAGLNEVSSLYPELSKVLTSMAR
A0A1P8C849_E1B19K-      TNIHVGGRNEGGHGQEPEERPGPSVGRGAGLNEVSSLYPELSKVLTSMAR
A0A1P7YYY5_E1B19K-      TNIHVGGRNKGGHGQEPEERPGPSVGRGAGLNEVSSLYPELSKVLTSMAR
A0A1P7YYY5_E1B19K-      -------------------------------MDVWSILGEFNK-----TR
A0A1P7YWR9_E1B19K-      -------------------------------MDVWSILGEFNK-----TR
A0A1P7YWY2_E1B19K-      -------------------------------MDVWSILGEFNK-----TR
A0A1P7YXN8_E1B19K-      -------------------------------MDVWSILGEFNK-----TR
B9A5A7_E1B19K-01        -------------------------------MDVWSILGEFNK-----TR
A0A1P8C849_E1B19K-      -------------------------------MDVWSILGEFNK-----TR
                                                        :* *:  *:.*     :*

A0A1P7YWR9_E1B19K-      GVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDK
A0A1P7YWY2_E1B19K-      GVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDK
A0A1P7YXN8_E1B19K-      GVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDK
A0A1P8C849_E1B19K-      GVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDK
A0A1P7YYY5_E1B19K-      GVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDK
A0A1P7YYY5_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
A0A1P7YWR9_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
A0A1P7YWY2_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
A0A1P7YXN8_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
B9A5A7_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
A0A1P8C849_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
                         :  : *** .                                 *: . .

A0A1P7YWR9_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYIS
A0A1P7YWY2_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYIS
A0A1P7YXN8_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYIS
A0A1P8C849_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYIS
A0A1P7YYY5_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYIS
A0A1P7YYY5_E1B19K-      FGTPLSRLVYTVKKDYSEEFENLFA------DCS-GLLDSLNFGHQS---
A0A1P7YWR9_E1B19K-      FGTPLSRLVYTVKKDYSEEFENIFA------DCS-GLLDSLNFGHQS---
A0A1P7YWY2_E1B19K-      FGTPLSRLVYTVKKDYSEEFENIFA------DCS-CLLDSLNFGHQS---
A0A1P7YXN8_E1B19K-      FGTPLSRLVYTVKKDYSEEFENIFA------DCS-CLLDSLNFGHQS---
B9A5A7_E1B19K-01        FGTPLSRLVYTVKKDYSEEFENLFA------DCS-GLLDSLNFGHQS---
A0A1P8C849_E1B19K-      FGTPLSRLVYTVKKDYSEEFENLFA------DCS-GLLDSLNFGHQS---
                        :*    .  :   .:  **  : :*      **.  : .::*: * .   

A0A1P7YWR9_E1B19K-      GNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLF
A0A1P7YWY2_E1B19K-      GNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLF
A0A1P7YXN8_E1B19K-      GNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLF
A0A1P8C849_E1B19K-      GNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLF
A0A1P7YYY5_E1B19K-      GNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLF
A0A1P7YYY5_E1B19K-      --------------------------LFQERVLHSLDFSSPGRTTAGVAF
A0A1P7YWR9_E1B19K-      --------------------------LFQERVLHSLDFSSPGRTTAGVAF
A0A1P7YWY2_E1B19K-      --------------------------LFQERVLHSLDFSSPGRTTAGVAF
A0A1P7YXN8_E1B19K-      --------------------------LFQERVLHSLDFSSPGRTTAGVAF
B9A5A7_E1B19K-01        --------------------------LFQERVLHSLDFSSPGRTTAGVAF
A0A1P8C849_E1B19K-      --------------------------LFQERVLHSLDFSSPGRTTAGVAF
                                                  ::: . :  :::.  * .  ** *

A0A1P7YWR9_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
A0A1P7YWY2_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
A0A1P7YXN8_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
A0A1P8C849_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
A0A1P7YYY5_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
A0A1P7YYY5_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWMRQRGQRILNYWL----
A0A1P7YWR9_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWMRQRGQRILNYWL----
A0A1P7YWY2_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWMRQRGQRILNYWL----
A0A1P7YXN8_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWMRQRGQRILNYWL----
B9A5A7_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWMRQRGQRILNYWL----
A0A1P8C849_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWMRQRGQRILNYWL----
                        :.      ..   *    ::.*  *   :* *  . ** .: . *:    

A0A1P7YWR9_E1B19K-      RPKSEMSVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P7YWY2_E1B19K-      RPKSEMSVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P7YXN8_E1B19K-      RPKSEMSVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P8C849_E1B19K-      RPKSEMSVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P7YYY5_E1B19K-      RPKSEMSVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
                                                                          

A0A1P7YWR9_E1B19K-      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A1P7YWY2_E1B19K-      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A1P7YXN8_E1B19K-      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A1P8C849_E1B19K-      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A1P7YYY5_E1B19K-      NVVKGCTDERMYNMLTCDSGVCHILKNMHVTSHPRKKWPVFENNLLIKCH
A0A1P7YYY5_E1B19K-      -------------LQPAASGLLHLHRQTS---------------------
A0A1P7YWR9_E1B19K-      -------------LQPAASGLLHLHRQTS---------------------
A0A1P7YWY2_E1B19K-      -------------LQPAASGLLHLHRQTS---------------------
A0A1P7YXN8_E1B19K-      -------------LQPAASGLLHLHRQTS---------------------
B9A5A7_E1B19K-01        -------------LQPAASGLLHLHRQTS---------------------
A0A1P8C849_E1B19K-      -------------LQPAALGLLHLHRQTS---------------------
                                     : ..  *: *: .:                       

A0A1P7YWR9_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A1P7YWY2_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A1P7YXN8_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A1P8C849_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A1P7YYY5_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A1P7YYY5_E1B19K-      ----------------------MLEEEIREAMDKNPRSGLD---------
A0A1P7YWR9_E1B19K-      ----------------------MLEEEMREAMDKNPRSGLD---------
A0A1P7YWY2_E1B19K-      ----------------------MLEEEMRESMDKNPRSGLD---------
A0A1P7YXN8_E1B19K-      ----------------------MLEEEMREAMDKNPRSGLD---------
B9A5A7_E1B19K-01        ----------------------MLEEEMREAMDKNPRSGLD---------
A0A1P8C849_E1B19K-      ----------------------MLEEEMREAMDKNPRSGLD---------
                                              :**::  . :: *   .:*         

A0A1P7YWR9_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A1P7YWY2_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A1P7YXN8_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A1P8C849_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A1P7YYY5_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A1P7YYY5_E1B19K-      --------------------------------------------PPLEEE
A0A1P7YWR9_E1B19K-      --------------------------------------------PPSEEE
A0A1P7YWY2_E1B19K-      --------------------------------------------PPSEEE
A0A1P7YXN8_E1B19K-      --------------------------------------------PPSEEE
B9A5A7_E1B19K-01        --------------------------------------------PPSEEE
A0A1P8C849_E1B19K-      --------------------------------------------PPSEEE
                                                                    ..  *:

A0A1P7YWR9_E1B19K-      TD
A0A1P7YWY2_E1B19K-      TD
A0A1P7YXN8_E1B19K-      TD
A0A1P8C849_E1B19K-      TD
A0A1P7YYY5_E1B19K-      TD
A0A1P7YYY5_E1B19K-      LD
A0A1P7YWR9_E1B19K-      LD
A0A1P7YWY2_E1B19K-      LD
A0A1P7YXN8_E1B19K-      LD
B9A5A7_E1B19K-01        LD
A0A1P8C849_E1B19K-      LD
                         *

© 1998-2021Legal notice