Dataset for protein adenoviridae of organism Human adenovirus D serotype 17

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1DT57_E1B19K-01      --------------------------------------------------
F1DT57_E1B19K-02      MEPEHPTEQGLHSGLRSHAPVEGMGQAAGTENLELLASTASSSGSSSSTQ
                                                                        

F1DT57_E1B19K-01      -------------------------------MDVWTILADFSKTRRLV--
F1DT57_E1B19K-02      TNIHVGGRNEAGHGREPEERSGPSVGRGVGLNQVSSLYPELSKVLTSMAR
                                                      :* :: .::**.   :  

F1DT57_E1B19K-01      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
F1DT57_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDK
                          * *..* :*:     .: :.*        * :::: .:*:      

F1DT57_E1B19K-01      ---------------------------NLFADCSGLL-DSLNLGHQSLFQ
F1DT57_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
                                                  * .**. :: .::*: * . :.

F1DT57_E1B19K-01      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
F1DT57_E1B19K-02      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * *: :**                         :.  * .  ** *

F1DT57_E1B19K-01      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLLQPA
F1DT57_E1B19K-02      MA------NSHMTLHGCDFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
                      :.      ..:  *    ::.*  *   :* *  . ** .: . *:   .

F1DT57_E1B19K-01      AP----------------------------------GLLRLHRQTSMLEE
F1DT57_E1B19K-02      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
                       *                                  * : * . *: *: 

F1DT57_E1B19K-01      EMRQAMDEN-----------------------------------------
F1DT57_E1B19K-02      NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNMLIKCH
                      :* :.  ::                                         

F1DT57_E1B19K-01      -----PRSGLDP--------------------------------------
F1DT57_E1B19K-02      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
                            *. ::*                                      

F1DT57_E1B19K-01      ---------------------------------------------PSEEE
F1DT57_E1B19K-02      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
                                                                   .* *:

F1DT57_E1B19K-01      LD
F1DT57_E1B19K-02      TD
                       *

© 1998-2020Legal notice