Dataset for protein E1B 19K of organism Human adenovirus C serotype 2

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4P2SGW2_E1B19K-      MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGAAAA
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
                                                                          

A0A4P2SGW2_E1B19K-      AAAAGGSQAAAAAGAEPMEPESRPGPSGMNVVQVAELYPELRRILTITED
A0A4P2SGW2_E1B19K-      ----------------------------MEAWECLEDFSAVRNLLEQSSN
A0A1U9ALK7_E1B19K-      ----------------------------MEAWECLEDFSAVRNLLEQSSN
A0A6M5E4Y6_E1B19K-      ----------------------------MEAWECLEDFSAVRNLLEQSSN
P03247_E1B19K-01        ----------------------------MEAWECLEDFSAVRNLLEQSSN
                                                    *:. :  * :. :*.:*  :.:

A0A4P2SGW2_E1B19K-      GQG-----LKGVKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNC
A0A4P2SGW2_E1B19K-      STSWFWRFLWGSSQAKLVCRIKEDYK--------------WEFEELLKSC
A0A1U9ALK7_E1B19K-      STSWFWRFLWGSSQAKLVCRIKEDYK--------------WEFEELLKSC
A0A6M5E4Y6_E1B19K-      STSWFWRFLWGSSQAKLVCRIKEDYK--------------WEFEELLKSC
P03247_E1B19K-01        STSWFWRFLWGSSQAKLVCRIKEDYK--------------WEFEELLKSC
                        . .     *.* .. . .*  .*: .                *::: ..*

A0A4P2SGW2_E1B19K-      ANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKL
A0A4P2SGW2_E1B19K-      GELFDSLNLGHQA-------------------LFQEKVIK----------
A0A1U9ALK7_E1B19K-      GELFDSLNLGHQA-------------------LFQEKVIK----------
A0A6M5E4Y6_E1B19K-      GELFDSLNLGHQA-------------------LFQEKVIK----------
P03247_E1B19K-01        GELFDSLNLGHQA-------------------LFQEKVIK----------
                        .: :* *   :.                    :: : .:.          

A0A4P2SGW2_E1B19K-      VNIRNCCYISGNGAEVEIDTEDR----VAFRCSMINMWPGVLGMDGVVIM
A0A4P2SGW2_E1B19K-      --------------TLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLL
A0A1U9ALK7_E1B19K-      --------------TLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLL
A0A6M5E4Y6_E1B19K-      --------------TLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLL
P03247_E1B19K-01        --------------TLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLL
                                       :::.* .*    *** . : : *.    :.*  ::

A0A4P2SGW2_E1B19K-      NVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYC
A0A4P2SGW2_E1B19K-      DF-----------------LAMH---------------------------
A0A1U9ALK7_E1B19K-      DF-----------------LAMH---------------------------
A0A6M5E4Y6_E1B19K-      DF-----------------LAMH---------------------------
P03247_E1B19K-01        DF-----------------LAMH---------------------------
                        :.                 * :*                           

A0A4P2SGW2_E1B19K-      CWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVK
A0A4P2SGW2_E1B19K-      LWRAVV-RHKNRL-------------------------------------
A0A1U9ALK7_E1B19K-      LWRAVV-RHKNRL-------------------------------------
A0A6M5E4Y6_E1B19K-      LWRAVV-RHKNRL-------------------------------------
P03247_E1B19K-01        LWRAVV-RHKNRL-------------------------------------
                         *..** * *.*                                      

A0A4P2SGW2_E1B19K-      SVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
                                                                          

A0A4P2SGW2_E1B19K-      NILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMK
A0A4P2SGW2_E1B19K-      -------LLLSSVRPAIIP-------------------------------
A0A1U9ALK7_E1B19K-      -------LLLSSVRPAIIP-------------------------------
A0A6M5E4Y6_E1B19K-      -------LLLSSVRPAIIP-------------------------------
P03247_E1B19K-01        -------LLLSSVRPAIIP-------------------------------
                               * *.. * .::*                               

A0A4P2SGW2_E1B19K-      IWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAE
A0A4P2SGW2_E1B19K-      ------TEEQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE---------
A0A1U9ALK7_E1B19K-      ------TEE-----QQQEEARRRRRQEQSPWNPRAGLDPRE---------
A0A6M5E4Y6_E1B19K-      ------TEE-----QQQEEARRRRRQEQSPWNPRAGLDPRE---------
P03247_E1B19K-01        ------TEE-----QQQEEARRRRRQEQSPWNPRAGLDPRE---------
                               :*     .  * . .. *::    :    * *           

A0A4P2SGW2_E1B19K-      FGSSDEDTD
A0A4P2SGW2_E1B19K-      ---------
A0A1U9ALK7_E1B19K-      ---------
A0A6M5E4Y6_E1B19K-      ---------
P03247_E1B19K-01        ---------
                                 

© 1998-2021Legal notice