Dataset for protein E1B 19K of organism Human adenovirus C serotype 2

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4P2SGW2_E1B19K-      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
A0A1U9ALK7_E1B19K-      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
P03247_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
                        **************************************************

A0A4P2SGW2_E1B19K-      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
A0A1U9ALK7_E1B19K-      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
P03247_E1B19K-01        FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
                        **************************************************

A0A4P2SGW2_E1B19K-      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
A0A1U9ALK7_E1B19K-      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--
P03247_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--
                        ************************************************  

A0A4P2SGW2_E1B19K-      QQQQQQEEARRRRRQEQSPWNPRAGLDPRE
A0A1U9ALK7_E1B19K-      ---QQQEEARRRRRQEQSPWNPRAGLDPRE
P03247_E1B19K-01        ---QQQEEARRRRRQEQSPWNPRAGLDPRE
                           ***************************

© 1998-2020Legal notice