Dataset for protein E1B 19K of organism Human adenovirus C serotype 1

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q71BY5_E1B19K-03        MRHIICHGGVITEEMAASLLDQLIEEVLCLNLSLSPS-------------
A0A5K6WAR5_E1B19K-      MEAWECLEDFFA-----------VRNLLEQSSNSTSWFWRFLWGSSQAKL
A0A7D6TSN5_E1B19K-      MEAWECLEDFSA-----------VRNLLEQSSNSTSWFWRFLWGSSQAKL
Q71BY5_E1B19K-04        MEAWECLEDFSA-----------VRNLLEQSSNSTSWFWRFLWGSSQAKL
Q71BY5_E1B19K-01        MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHF-----------E
Q71BY5_E1B19K-02        MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHF-----------E
                        *    *  .. :           : ::*  .   ..              

Q71BY5_E1B19K-03        ---------------------------------------QNRNLQDLPG-
A0A5K6WAR5_E1B19K-      VCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDF-STPG-
A0A7D6TSN5_E1B19K-      VCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDF-STPG-
Q71BY5_E1B19K-04        VCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDF-STPG-
Q71BY5_E1B19K-01        PPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAAQEGIDLLTFPPAPGS
Q71BY5_E1B19K-02        PPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAAQEGIDLLTFPPAPGS
                                                               .   :   ** 

Q71BY5_E1B19K-03        --------------------------------------------------
A0A5K6WAR5_E1B19K-      ---------------RAAAAVAFLSFIKDKWSEETHLSG-----------
A0A7D6TSN5_E1B19K-      ---------------RAAAAVAFLSFIKDKWSEETHLSG-----------
Q71BY5_E1B19K-04        ---------------RAAAAVAFLSFIKDKWSEETHLSG-----------
Q71BY5_E1B19K-01        PEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEG
Q71BY5_E1B19K-02        PEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEG
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
A0A5K6WAR5_E1B19K-      -GYLLDFLAM----------------------------------------
A0A7D6TSN5_E1B19K-      -GYLLDFLAM----------------------------------------
Q71BY5_E1B19K-04        -GYLLDFLAM----------------------------------------
Q71BY5_E1B19K-01        EEFVLDYVEQPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSE
Q71BY5_E1B19K-02        ----------------------------------------------PVSE
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
A0A5K6WAR5_E1B19K-      ------------------HLWRAVVRHK----------------------
A0A7D6TSN5_E1B19K-      ------------------HLWRAVVRHK----------------------
Q71BY5_E1B19K-04        ------------------HLWRAVVRHK----------------------
Q71BY5_E1B19K-01        PEPEPEPEPEPARPARRPKMVPAILRRPTSPVSRECNSSTDSCDSGPSNT
Q71BY5_E1B19K-02        PEPEPEPEPEPARPARRPKMVPAILRRPTSPVSRECNSSTDSCDSGPSNT
                                                                          

Q71BY5_E1B19K-03        ------VLKWCLLS------------------------------------
A0A5K6WAR5_E1B19K-      ----NRLLLLSSVRPAIIPTEEQQQQQEEA-----RRRRRQEQSPWNPRA
A0A7D6TSN5_E1B19K-      ----NRLLLLSSVRPAIIPTEEQQQQQQQQQEEARRRRRRQEQSPWNPRA
Q71BY5_E1B19K-04        ----NRLLLLSSVRPAIIPTEEQQQQQQQQEEA--RRRRRQEQSPWNPRA
Q71BY5_E1B19K-01        PPEIHPVVPLCPIKPVAVRVGGRRRAVECIEDLLNEPGQPLDLSCKRPRP
Q71BY5_E1B19K-02        PPEIHPVVPLCPIKPVAVRVGGRRRAVECIEDLLNEPGQPLDLSCKRPRP
                              ::  . :                                     

Q71BY5_E1B19K-03        ------
A0A5K6WAR5_E1B19K-      GLDPRE
A0A7D6TSN5_E1B19K-      GLDPRE
Q71BY5_E1B19K-04        GLDPRE
Q71BY5_E1B19K-01        ------
Q71BY5_E1B19K-02        ------
                              

© 1998-2021Legal notice