Dataset for protein E1B 19K of organism Human adenovirus A serotype 31

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5H2QAX5_E1B19K-      MEREVPPELGLHAGLHDNAFVEGMAEEEGLHLLAGAASNHAAVAGGAAEH
A0A5H2QAX5_E1B19K-      --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
                                                                          

A0A5H2QAX5_E1B19K-      YDGGVNMEPQVQEGHEPDPDEGPSCAVVKKRERKESLKEAVLNRLTVNLM
A0A5H2QAX5_E1B19K-      --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
                                                                          

A0A5H2QAX5_E1B19K-      SRPRLETVYWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLECAIKA
A0A5H2QAX5_E1B19K-      -----------------------------------------MELEAVLQS
D0Z5R9_E1B19K-01        -----------------------------------------MELEAVLQS
                                                                  :**..:::

A0A5H2QAX5_E1B19K-      FAKVALRPDCTYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCRMQGM
A0A5H2QAX5_E1B19K-      FQSVRQLLQYTSKNT-----------------------------------
D0Z5R9_E1B19K-01        FQSVRQLLQYTSKNT-----------------------------------
                        * .*    : * * :                                   

A0A5H2QAX5_E1B19K-      GPGVVGLDGITFMNVRFAGEKFKGIMFEANTSVVLHGV---YFLNFNNTC
A0A5H2QAX5_E1B19K-      -------------------SGFWRYLFGSTLSKVVHRVKEDYREEFENIL
D0Z5R9_E1B19K-01        -------------------SGFWRYLFGSTLSKVVHRVKEDYREEFENIL
                                           . *.  :* :. * *:* *   *  :*:*  

A0A5H2QAX5_E1B19K-      VECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKCVLALIVEGDAH
A0A5H2QAX5_E1B19K-      ADCPGLLASLDLCHHSVFQERVVRSLDFSSSGRTVASIAFLATVLD----
D0Z5R9_E1B19K-01        ADCPGLLASLDLCHHSVFQERVVRSLDFSSSGRTVASIAFLATVLD----
                        .:* . ::: .  .:. ::  * *. .  *  . : . ..** :::    

A0A5H2QAX5_E1B19K-      IRHNAASENTCFILLKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKT
A0A5H2QAX5_E1B19K-      --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
                                                                          

A0A5H2QAX5_E1B19K-      VHIVSHARYCWPVCDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVLLEPE
A0A5H2QAX5_E1B19K-      -KWSERSHLSWD------YMLDYMTMHLWRAWLKRRVCIYSLAR------
D0Z5R9_E1B19K-01        -KWSERSHLSWD------YMLDYMAMHLWRAWLKRRVCIYSLAR------
                         :  ..:. .*       :*   : : *.*. :.   * :* :.      

A0A5H2QAX5_E1B19K-      AFSRVSLNGVFDLSVELCKIIRYDDAARHRCRQCECGSSHLELRPVMLNV
A0A5H2QAX5_E1B19K-      --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
                                                                          

A0A5H2QAX5_E1B19K-      TEELRSDHLTLSCLRTDYDSSDEDN
A0A5H2QAX5_E1B19K-      -------PLTMPPLQEEQQNTTTEE
D0Z5R9_E1B19K-01        -------PLTMPPLQEEQQNTTTEE
                                **:. *. : :.:  ::

© 1998-2020Legal notice