Dataset for protein adenoviridae of organism Human adenovirus 7d

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A897JQR0_E1B19K-      --------------------------------------------------
A0A897JQR0_E1B19K-      MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETP
                                                                          

A0A897JQR0_E1B19K-      ------------------------MEVWAILEDLRQTRLLLENASDG---
A0A897JQR0_E1B19K-      TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELR--RVLTRSTTSGQNR
                                                  *  :: :**  *:*  .::.*   

A0A897JQR0_E1B19K-      --------------------------------------------------
A0A897JQR0_E1B19K-      GIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
                                                                          

A0A897JQR0_E1B19K-      -VSGLWRFWFGGD---------LARLVFRIKQDYSVEFEKLLDDS-----
A0A897JQR0_E1B19K-      SLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISG
                         :. *.  *:  :          *.: :* .::* :  :  : ::     

A0A897JQR0_E1B19K-      PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAFL
A0A897JQR0_E1B19K-      NGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFM
                         *    ::   :* *.             :.::::::   *    .:.*:

A0A897JQR0_E1B19K-      T----------------FILDKW----IRQTHFSKGYVLD----------
A0A897JQR0_E1B19K-      ANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSV
                        :                  :: *    :*   *   ::            

A0A897JQR0_E1B19K-      --------------------------------------------------
A0A897JQR0_E1B19K-      KKCMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD
                                                                          

A0A897JQR0_E1B19K-      --------------------FIAAALWRTW--------------------
A0A897JQR0_E1B19K-      ERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRG
                                            .*.:  ...*                    

A0A897JQR0_E1B19K-      -------KARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPR
A0A897JQR0_E1B19K-      MFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVR
                               : ..:..:*:  ... :.::**:     :  :*. :: : . *

A0A897JQR0_E1B19K-      A-----------------------------------GLDPPVEE
A0A897JQR0_E1B19K-      ACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
                        *                                   * .    :

© 1998-2022Legal notice