Dataset for protein E1B 19K of organism Human adenovirus 7d2

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


R4HMC6_E1B19K-01      --------------------------------------------------
R4HMC6_E1B19K-02      MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETP
                                                                        

R4HMC6_E1B19K-01      ------------------------MEVWAILEDLRQTRLLLENASDG---
R4HMC6_E1B19K-02      TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELR--RVLTRSTTSGQNR
                                                *  :: :**  *:*  .::.*   

R4HMC6_E1B19K-01      --------------------------------------------------
R4HMC6_E1B19K-02      GIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
                                                                        

R4HMC6_E1B19K-01      -VSGLWRFWFGGD---------LARLVFRIKQDYSVEFEKLLDDS-----
R4HMC6_E1B19K-02      SLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISG
                       :. *.  *:  :          *.: :* .::* :  :  : ::     

R4HMC6_E1B19K-01      PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAFL
R4HMC6_E1B19K-02      NGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFM
                       *    ::   :* *.             :.::::::   *    .:.*:

R4HMC6_E1B19K-01      T----------------FILDKW----IRQTHFSKGYVLD----------
R4HMC6_E1B19K-02      ANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSV
                      :                  :: *    :*   *   ::            

R4HMC6_E1B19K-01      --------------------------------------------------
R4HMC6_E1B19K-02      KKCMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD
                                                                        

R4HMC6_E1B19K-01      --------------------FIAAALWRTW--------------------
R4HMC6_E1B19K-02      ERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRG
                                          .*.:  ...*                    

R4HMC6_E1B19K-01      -------KARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPR
R4HMC6_E1B19K-02      MFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVR
                             : ..:..:*:  ... :.::**:     :  :*. :: : . *

R4HMC6_E1B19K-01      A-----------------------------------GLDPPVEE
R4HMC6_E1B19K-02      ACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
                      *                                   * .    :

© 1998-2020Legal notice