Dataset for protein E1B 19K of organism Human adenovirus 71

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


T1UHL7_E1B19K-01      --------------------------------------------------
T1UHL7_E1B19K-02      MEPGHPTEQGLHPGLRSHAPVEVLDQAAGTENLELLASTASSSGSSSSTQ
                                                                        

T1UHL7_E1B19K-01      -------------------------------MDVWTILADFSK-----TR
T1UHL7_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
                                                      :* :: .::**     :*

T1UHL7_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
T1UHL7_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDK
                       :  : *** .                                 *: . .

T1UHL7_E1B19K-01      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
T1UHL7_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
                      :*    .  : . .:*::* :::     * .**.  : .::*: * . :.

T1UHL7_E1B19K-01      ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKWSQDT------
T1UHL7_E1B19K-02      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * *: :** ::      *       :  ::*:  *:. :.      

T1UHL7_E1B19K-01      ------QLSRGYILDFAAM--HLWRSWIRQRGQRILNYWLLQPAAP----
T1UHL7_E1B19K-02      MANSHMTLHGCNFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVGRPKSEM
                             *    ::.*  *   :* :  . ** .: . *:   . *    

T1UHL7_E1B19K-01      ------------------------------GLLRLHRQTSMLEEEMRQAM
T1UHL7_E1B19K-02      SVKQCVFEKCYLAVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
                                                    * : * . *: *: :* :. 

T1UHL7_E1B19K-01      DEN----------------------------------------------P
T1UHL7_E1B19K-02      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
                       ::                                               

T1UHL7_E1B19K-01      RSGLDP--------------------------------------------
T1UHL7_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSR
                      *. ::*                                            

T1UHL7_E1B19K-01      ---------------------------------------PSEEELD
T1UHL7_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                                             .* *: *

© 1998-2020Legal notice