Dataset for protein adenoviridae of organism Human adenovirus 68

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7NG43_E1B19K-01      --------------------------------------------------
K7NG43_E1B19K-02      MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
                                                                        

K7NG43_E1B19K-01      ------------------------MEVWAILEDLRQTRLLLENASDGVSG
K7NG43_E1B19K-02      TGHASGSGGGAAGGQSESRPGPSGGGVADLFPELR--RVLTRSTSSGQDR
                                                *  :: :**  *:*  .:*.* . 

K7NG43_E1B19K-01      ------------------------------FWR-----------------
K7NG43_E1B19K-02      GIKRERNPSGNNLRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
                                                    :*.                 

K7NG43_E1B19K-01      -------FWFGGD---------LARLVFRIKQDYREEFEKLLDDS-----
K7NG43_E1B19K-02      SLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYILG
                              *:  :          *.: :* .::**   :  : ::     

K7NG43_E1B19K-01      PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAFL
K7NG43_E1B19K-02      NGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFRGDGYNGIVFM
                       *    ::   :* *.             :.::.:::   *    .:.*:

K7NG43_E1B19K-01      T----------------FILDKW----IRQTHFSKGYVLD----------
K7NG43_E1B19K-02      ANTKLILHGCSFFGVNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSA
                      :                  :: *    :*   *   ::            

K7NG43_E1B19K-01      --------------------------------------------------
K7NG43_E1B19K-02      KKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD
                                                                        

K7NG43_E1B19K-01      --------------------FIAAALWRTW--------------------
K7NG43_E1B19K-02      ERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRG
                                          .*.:  ...*                    

K7NG43_E1B19K-01      -------KARRMRTILDYWPVQPLGVAGILRHPPAMPAVLEEEQQEDNPR
K7NG43_E1B19K-02      MFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVR
                             : ..:..:*:  ... :.::**:     :  :*  :: : . *

K7NG43_E1B19K-01      A-----------------------------------GLDPPVEE
K7NG43_E1B19K-02      ACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
                      *                                   * .    :

© 1998-2020Legal notice