Dataset for protein E1B 19K of organism Human adenovirus 60a

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1FC01_E1B19K-01      --------------------------------------------------
G1FC01_E1B19K-02      MEPEHPTEQGLHSGLRGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQ
                                                                        

G1FC01_E1B19K-01      -------------------------------MEVWTILGDFNK-----TR
G1FC01_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSRVLTSMAR
                                                      :* ::  ::..     :*

G1FC01_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
G1FC01_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
                       :  : *** .                                 *: . .

G1FC01_E1B19K-01      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNFGHQSLFQ
G1FC01_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
                      :*    .  : . .:*::* :::     * .**.  : .::*: * . :.

G1FC01_E1B19K-01      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
G1FC01_E1B19K-02      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMF
                          * *: :**                         :.  * .  ** *

G1FC01_E1B19K-01      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLLQPA
G1FC01_E1B19K-02      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
                      :.      ..:  *    ::.*  *   :* * .. ** .: . *:   .

G1FC01_E1B19K-01      AP----------------------------------GLLRLHRQTSMLEE
G1FC01_E1B19K-02      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
                       *                                  * : * . *: *: 

G1FC01_E1B19K-01      EMRQAMDEN-----------------------------------------
G1FC01_E1B19K-02      NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
                      :* :.  ::                                         

G1FC01_E1B19K-01      -----PRSGLDP--------------------------------------
G1FC01_E1B19K-02      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
                            *. ::*                                      

G1FC01_E1B19K-01      ---------------------------------------------PSEEE
G1FC01_E1B19K-02      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
                                                                   .* *:

G1FC01_E1B19K-01      LD
G1FC01_E1B19K-02      TD
                       *

© 1998-2020Legal notice