Dataset for protein adenoviridae of organism Human adenovirus 56

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E1AI10_E1B19K-01      --------------------------------------------------
E1AI10_E1B19K-02      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
                                                                        

E1AI10_E1B19K-01      -------------------------------MDVWTILADFSKTRRLV--
E1AI10_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
                                                      :* :: .::**.   :  

E1AI10_E1B19K-01      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
E1AI10_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDK
                          * *..* :*:     .: :.*        * :::: .:*:      

E1AI10_E1B19K-01      ---------------------------NIFADCSGLL-DSLNLGHQSLFQ
E1AI10_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
                                                  : .**. :: .::*: * . :.

E1AI10_E1B19K-01      ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKWSQDT------
E1AI10_E1B19K-02      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * *: :** ::      *       :  ::*:  *:. :.      

E1AI10_E1B19K-01      ------QLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPAAP----
E1AI10_E1B19K-02      MANSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVGRPKSEM
                             *    ::.*  *   :* *  . ** .: . *:   . *    

E1AI10_E1B19K-01      ------------------------------GLLRLHRQTSMLEEEMRQAM
E1AI10_E1B19K-02      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
                                                    * : * . *: *: :* :. 

E1AI10_E1B19K-01      DEN----------------------------------------------P
E1AI10_E1B19K-02      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
                       ::                                               

E1AI10_E1B19K-01      RSGLDP--------------------------------------------
E1AI10_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSR
                      *. ::*                                            

E1AI10_E1B19K-01      ---------------------------------------PSEEELD
E1AI10_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                                             .* *: *

© 1998-2022Legal notice