Dataset for protein E1B 19K of organism Human adenovirus 55

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7G5FB98_E1B19K-      MDPADSFQQGIRFGFRSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEAS
A0A7G5F9T0_E1B19K-      --------------MEVWAILEDLRKTR-----QLLENASDGVSG-----
C7SRS7_E1B19K-01        --------------MEVWAILEDLRKTR-----QLLENASDGVSG-----
J7H4R9_E1B19K-01        --------------MEVWAILEDLRKTR-----QLLENASDGVSG-----
A0A7G5FB98_E1B19K-      --------------MEVWAILEDLRKTR-----QLLESASDGVSG-----
                                      :  .:*:*::  :.     .** .*: * **     

A0A7G5FB98_E1B19K-      TGHASGSGGGTARGQPESRPGPSSGGGGVADLSPELQRVLTGFTSTGRDR
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
                                                                          

A0A7G5FB98_E1B19K-      GVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKY
A0A7G5F9T0_E1B19K-      ------------------------------FWR-----------------
C7SRS7_E1B19K-01        ------------------------------FWR-----------------
J7H4R9_E1B19K-01        ------------------------------FWR-----------------
A0A7G5FB98_E1B19K-      ------------------------------FWR-----------------
                                                      :*.                 

A0A7G5FB98_E1B19K-      SLEQVKTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISG
A0A7G5F9T0_E1B19K-      -------FWFASE---------LARVVFRIKQDYK---------------
C7SRS7_E1B19K-01        -------FWFASE---------IARVVFRIKQDYK---------------
J7H4R9_E1B19K-01        -------FWFASE---------LARVVFRIKQDYK---------------
A0A7G5FB98_E1B19K-      -------FWFASE---------LARVVFRIKQDYK---------------
                                *: .*          *.:.:* .::**               

A0A7G5FB98_E1B19K-      NGAEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFM
A0A7G5F9T0_E1B19K-      -------EEFEKLLVDC------PGLFEALNLGH-QVHFKEKVLSVLDFS
C7SRS7_E1B19K-01        -------EEFEKLLVDC------PGLFEALNLGH-QVHFKEKVLSVLDFS
J7H4R9_E1B19K-01        -------EEFEKLLVDC------PGLFEALNLGH-QVHFKEKVLSVLDFS
A0A7G5FB98_E1B19K-      -------EEFEKLLVDC------PGLFEALNLGH-QVHFKEKVLSVLDFS
                               :  :* :: *      **:.    : . :*:*. .  . : * 

A0A7G5FB98_E1B19K-      ANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSL
A0A7G5F9T0_E1B19K-      TPGRT----AAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRK
C7SRS7_E1B19K-01        TPGRT----AAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRK
J7H4R9_E1B19K-01        TPGRT----AAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRK
A0A7G5FB98_E1B19K-      TPGRT----AAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRK
                        :  .     .: ..* .  :* *   :  . .:   ::*** . . ::  

A0A7G5FB98_E1B19K-      KKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD
A0A7G5F9T0_E1B19K-      MRTILGY-------------------------------------------
C7SRS7_E1B19K-01        MRTILGY-------------------------------------------
J7H4R9_E1B19K-01        MRTILGY-------------------------------------------
A0A7G5FB98_E1B19K-      MRTILGY-------------------------------------------
                         . *:                                             

A0A7G5FB98_E1B19K-      ERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
A0A7G5F9T0_E1B19K-      -----------------------------WPV------------------
C7SRS7_E1B19K-01        -----------------------------WPV------------------
J7H4R9_E1B19K-01        -----------------------------WPV------------------
A0A7G5FB98_E1B19K-      -----------------------------WPV------------------
                                                     ***                  

A0A7G5FB98_E1B19K-      MFMPYQCNMNHVKVLLEPDAFSRMSLTGMFDMNMQIWKILRYDDTRSRVR
A0A7G5F9T0_E1B19K-      ---------------------QPLGVAGIL--------------------
C7SRS7_E1B19K-01        ---------------------QPLGVAGIL--------------------
J7H4R9_E1B19K-01        ---------------------QPLGVAGIL--------------------
A0A7G5FB98_E1B19K-      ---------------------QPLGVAGIL--------------------
                                             . :.::*::                    

A0A7G5FB98_E1B19K-      ACECGGKHARFQPVCVDVTEDLRPDHLVIARTGAEFGSSGEETD
A0A7G5F9T0_E1B19K-      ---------RHLPVMPAVLEEEQQED----NPRAGLDPPVEEAE
C7SRS7_E1B19K-01        ---------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE
J7H4R9_E1B19K-01        ---------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE
A0A7G5FB98_E1B19K-      ---------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE
                                 *. **   * *: . :     .. * :... **::

© 1998-2022Legal notice