Dataset for protein E1B 19K of organism Human adenovirus 55

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7G5F9T0_E1B19K-      MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEE
C7SRS7_E1B19K-01        MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASEIARVVFRIKQDYKEE
J7H4R9_E1B19K-01        MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEE
A0A7G5FB98_E1B19K-      MEVWAILEDLRKTRQLLESASDGVSGFWRFWFASELARVVFRIKQDYKEE
                        ******************.****************:**************

A0A7G5F9T0_E1B19K-      FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
C7SRS7_E1B19K-01        FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
J7H4R9_E1B19K-01        FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
A0A7G5FB98_E1B19K-      FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
                        **************************************************

A0A7G5F9T0_E1B19K-      DKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILR
C7SRS7_E1B19K-01        DKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILR
J7H4R9_E1B19K-01        DKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILR
A0A7G5FB98_E1B19K-      DKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILR
                        **************************************************

A0A7G5F9T0_E1B19K-      HLPVMPAVLEEEQQEDNPRAGLDPPVEEAE
C7SRS7_E1B19K-01        HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE
J7H4R9_E1B19K-01        HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE
A0A7G5FB98_E1B19K-      HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE
                        * ****************************

© 1998-2022Legal notice