Dataset for protein E1B 19K of organism Human adenovirus 51

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QVT4_E1B19K-01      --------------------------------------------------
M0QVT4_E1B19K-02      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
                                                                        

M0QVT4_E1B19K-01      -------------------------------MDVWTILADFSK-----TR
M0QVT4_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVASLYPELSKVLTTMAR
                                                      :* :: .::**     :*

M0QVT4_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
M0QVT4_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
                       :  : *** .                                 *: . .

M0QVT4_E1B19K-01      FGTPLSRLVY-TVKKDYKEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
M0QVT4_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYIS
                      :*    .  : . .:*::* :::     * .**.  : .::*: * . :.

M0QVT4_E1B19K-01      ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKWSQDT------
M0QVT4_E1B19K-02      GNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * :: :** *:      *       :  ::*:  *:. :.      

M0QVT4_E1B19K-01      ------QLSRGYILDFAAM--HLWRAWIRQRGQRILNYWL----------
M0QVT4_E1B19K-02      MANSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVGRPKSEM
                             *    ::.*  *   :* *  . ** .: . *:          

M0QVT4_E1B19K-01      -----------LQPAAPGLLRLHRQTSM----------------------
M0QVT4_E1B19K-02      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
                                 *  :: *  *:.. :*:                      

M0QVT4_E1B19K-01      --------------------------------------------------
M0QVT4_E1B19K-02      TDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGAR
                                                                        

M0QVT4_E1B19K-01      --------------------------------------------------
M0QVT4_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSR
                                                                        

M0QVT4_E1B19K-01      -------------------LEEEMRQAMDENPRSGLD-PPSEEELD
M0QVT4_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                         : **:*      . :* : ..* *: *

© 1998-2020Legal notice