Dataset for protein E1B 19K of organism Human adenovirus 50

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q3ZKW2_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-02      MDPTNPLQQGIRFGFHSSSFVENMEGSQHEDNLRLLASAASGSSRDTETP
                                                                        

Q3ZKW2_E1B19K-01      ------------------------MEVWAILEDLRQTRLLLENASDGVSG
Q3ZKW2_E1B19K-02      TDHASGSGGGAAGGQSESRPGPSGGGVADLFPELR--RVLTRSTSSGQDR
                                                *  :: :**  *:*  .:*.* . 

Q3ZKW2_E1B19K-01      ------------------------------FWR-----------------
Q3ZKW2_E1B19K-02      GIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
                                                    :*.                 

Q3ZKW2_E1B19K-01      -------FWFGGD---------LARLVFRIKQDYREEFEKLLDDS-----
Q3ZKW2_E1B19K-02      SLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISG
                              *:  :          *.: :* .::**   :  : ::     

Q3ZKW2_E1B19K-01      PGLFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAFL
Q3ZKW2_E1B19K-02      NGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFM
                       *    ::   :* *.             :.::.:::   *    .:.*:

Q3ZKW2_E1B19K-01      T----------------FILDKW----IRQTHFSKGYVLD----------
Q3ZKW2_E1B19K-02      ANTKLILHGCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQLSV
                      :                  :: *    :*   *   ::            

Q3ZKW2_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-02      KKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN
                                                                        

Q3ZKW2_E1B19K-01      --------------------FIAAALWRTW--------------------
Q3ZKW2_E1B19K-02      ERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRG
                                          .*.:  ...*                    

Q3ZKW2_E1B19K-01      -------KARSMRTILDYWPVQPLGVAGILRHPPTMPAVLEEEQQEDNPR
Q3ZKW2_E1B19K-02      MFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVR
                             : . :..:*:  ... :.::**:     :  :*  :: : . *

Q3ZKW2_E1B19K-01      A-----------------------------------GLDPPVEE
Q3ZKW2_E1B19K-02      ACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
                      *                                   * .    :

© 1998-2020Legal notice