Dataset for protein adenoviridae of organism Human adenovirus 47

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QUW8_E1B19K-01      --------------------------------------------------
M0QUW8_E1B19K-02      MEPANPPNQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQ
                                                                        

M0QUW8_E1B19K-01      -------------------------------MEVWTILADFNK-----TR
M0QUW8_E1B19K-02      TNIHVGGRDEGGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
                                                      :* :: .::.*     :*

M0QUW8_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
M0QUW8_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDK
                       :  : *** .                                 *: . .

M0QUW8_E1B19K-01      FGTPLARLVY-TVKKDYQEEFEN-----LFADCS-GLLDSLNLGHQALFQ
M0QUW8_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTINIRHACYIS
                      :*    .  : . .:*::* :::     * .**.  : .::*: * . :.

M0QUW8_E1B19K-01      ----ERVLHSLDFSSPGRTTAGVAF------------VVFLVDKWSQQTH
M0QUW8_E1B19K-02      GNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLF
                          * :: :** ::      *:              : *  :*:.   .

M0QUW8_E1B19K-01      LTRDYI---------LDFTAMHLWKAWVRQRGQRILNYWL----------
M0QUW8_E1B19K-02      MANSHMTLHGCNFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVGRPKSEM
                      ::..::         ::  .  :* *  . ** .: . *:          

M0QUW8_E1B19K-01      -----------LQPAAPGLLRLHRQTSM----------------------
M0QUW8_E1B19K-02      SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGC
                                 *  :: *  *:.. :**                      

M0QUW8_E1B19K-01      --------------------------------------------------
M0QUW8_E1B19K-02      TDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGAR
                                                                        

M0QUW8_E1B19K-01      --------------------------------------------------
M0QUW8_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSR
                                                                        

M0QUW8_E1B19K-01      -------------------LEEEMREAMDENPRSGLD-PPSEEELD
M0QUW8_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                         : **:*      . :* : ..* *: *

© 1998-2020Legal notice