Dataset for protein adenoviridae of organism Human adenovirus 43

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QVG6_E1B19K-01      --------------------------------------------------
M0QVG6_E1B19K-02      MEPANPSDQGLHPGLHGHASVEGLGQAAGTENLELLASTASSSGSSSSTQ
                                                                        

M0QVG6_E1B19K-01      -------------------------------MEVWTILADFSK-----TR
M0QVG6_E1B19K-02      TNIHVGGRNEGGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
                                                      :* :: .::**     :*

M0QVG6_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
M0QVG6_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
                       :  : *** .                                 *: . .

M0QVG6_E1B19K-01      FGTPLSRLVY-TVKKDYNEEFEN-----LFVDCS-GLLDSLNLGHQALFQ
M0QVG6_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYKVTKTVNIRHACYIS
                      :*    .  : . .:*::* :::     *  **.  : .::*: * . :.

M0QVG6_E1B19K-01      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDK-----------------W
M0QVG6_E1B19K-02      GNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * *: :** *:      *:   *: ::.                 :

M0QVG6_E1B19K-01      SQQTHLTRD----YILDFTAMHLWKAWVRQRGQRILNYWL----------
M0QVG6_E1B19K-02      MANSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVGRPKSEM
                        ::*:*      : ::  .  :* * .. ** .: . *:          

M0QVG6_E1B19K-01      -----------LQPAAPGLLRLHRQTSM----------------------
M0QVG6_E1B19K-02      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
                                 *  :: *  *:.. :*:                      

M0QVG6_E1B19K-01      --------------------------------------------------
M0QVG6_E1B19K-02      TDERMYNMLTCDSGVCHILKNIHVTSHARKKWPVFENNLLIKCHMHLGAR
                                                                        

M0QVG6_E1B19K-01      --------------------------------------------------
M0QVG6_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSR
                                                                        

M0QVG6_E1B19K-01      -------------------LEEEMREAMDENPRSGLD-PPSEEELD
M0QVG6_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                         : **:*      . :* : ..* *: *

© 1998-2020Legal notice