Dataset for protein E1B 19K of organism Human adenovirus 39

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QV87_E1B19K-01      --------------------------------------------------
M0QV87_E1B19K-02      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
                                                                        

M0QV87_E1B19K-01      -------------------------------MDVWTILGDFVK-----TR
M0QV87_E1B19K-02      TNIHVGGRDEGGHGREPEERPGPSVGRGAGLSQVSSLYPELSKVLTSMAR
                                                      :* ::  :: *     :*

M0QV87_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
M0QV87_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDK
                       :  : *** .                                 *: . .

M0QV87_E1B19K-01      FGTPLSRLVY-TVKKDYSEEFEN-----LFSDCS-GLLDSLNFGHQSLFQ
M0QV87_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
                      :*    .  : . .:*:.* :::     * .**.  : .::*: * . :.

M0QV87_E1B19K-01      ----ERVLHSLDFSTPGRTTAG-------VAFVVFLVDKWSQDT------
M0QV87_E1B19K-02      GNGAEVVVDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * *: :** ::      *       :  ::*:  *:. :.      

M0QV87_E1B19K-01      ------QLSRGYILDFAAM--HLWRAWIRQRGQRILNYWL----------
M0QV87_E1B19K-02      MANSHMTVHGCSFFGFNNMCAEIWGA-AKIRGCKFYGCWMGVVGRPKSEM
                             :    ::.*  *   :* *  . ** .: . *:          

M0QV87_E1B19K-01      -----------LQPAVPGLLRLHRQTSM----------------------
M0QV87_E1B19K-02      SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVVKGC
                                 *  :. *  *:.. :**                      

M0QV87_E1B19K-01      --------------------------------------------------
M0QV87_E1B19K-02      TDERMYNMLTCDSGVCHILKNIHVTSHSRKKWPVFENNLLIKCHMHLGAR
                                                                        

M0QV87_E1B19K-01      --------------------------------------------------
M0QV87_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSR
                                                                        

M0QV87_E1B19K-01      -------------------LEEEMREAMDENPRSGLD-PPSEEELD
M0QV87_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                         : **:*      . :* : ..* *: *

© 1998-2020Legal notice