Dataset for protein adenoviridae of organism Human adenovirus 28

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C4P207_E1B19K-01      --------------------------------------------------
C4P207_E1B19K-02      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
                                                                        

C4P207_E1B19K-01      -------------------------------MDVWTILADFSKTRRLV--
C4P207_E1B19K-02      TNIHVGGRNETGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
                                                      :* :: .::**.   :  

C4P207_E1B19K-01      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
C4P207_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDK
                          * *..* :*:     .: :.*        * :::: .:*:      

C4P207_E1B19K-01      ---------------------------NLFADCSGLL-DSLNLGHQSLFQ
C4P207_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
                                                  * .**. :: .::*: * . :.

C4P207_E1B19K-01      ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKWSQDT------
C4P207_E1B19K-02      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * *: :** ::      *       :  ::*:  *:. :.      

C4P207_E1B19K-01      ------QLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPAAP----
C4P207_E1B19K-02      MANSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVGRPKSEM
                             *    ::.*  *   :* *  . ** .: . *:   . *    

C4P207_E1B19K-01      ------------------------------GLLRLHRQTSMLEEEMRQAM
C4P207_E1B19K-02      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
                                                    * : * . *: *: :* :. 

C4P207_E1B19K-01      DEN----------------------------------------------P
C4P207_E1B19K-02      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
                       ::                                               

C4P207_E1B19K-01      RSGLDP--------------------------------------------
C4P207_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSR
                      *. ::*                                            

C4P207_E1B19K-01      ---------------------------------------PSEEELD
C4P207_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                                             .* *: *

© 1998-2020Legal notice