Dataset for protein E1B 19K of organism Human adenovirus 25

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QUJ3_E1B19K-01      --------------------------------------------------
M0QUJ3_E1B19K-02      MEPGHPTEQGIHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
                                                                        

M0QUJ3_E1B19K-01      -------------------------------MDVWTILADFSK-----TR
M0QUJ3_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
                                                      :* :: .::**     :*

M0QUJ3_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
M0QUJ3_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEIGLMQDK
                       :  : *** .                                 *: . .

M0QUJ3_E1B19K-01      FGTPLSRLVY-TVKKDYKEEFEN-----IFADCS-GLLDSLNLGHQSLFQ
M0QUJ3_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
                      :*    .  : . .:*::* :::     : .**.  : .::*: * . :.

M0QUJ3_E1B19K-01      ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKWSQDT------
M0QUJ3_E1B19K-02      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMF
                          * *: :** ::      *       :  ::*:  *:. :.      

M0QUJ3_E1B19K-01      ------QLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPAAP----
M0QUJ3_E1B19K-02      MANSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVGRPKSEM
                             *    ::.*  *   :* *  . ** .: . *:   . *    

M0QUJ3_E1B19K-01      ------------------------------GLLRLHRQTSMLEEEMRQAM
M0QUJ3_E1B19K-02      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
                                                    * : * . *: *: :* :. 

M0QUJ3_E1B19K-01      DEN----------------------------------------------P
M0QUJ3_E1B19K-02      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
                       ::                                               

M0QUJ3_E1B19K-01      RSGLDP--------------------------------------------
M0QUJ3_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSR
                      *. ::*                                            

M0QUJ3_E1B19K-01      ---------------------------------------PSEEELD
M0QUJ3_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                                             .* *: *

© 1998-2020Legal notice