Dataset for protein adenoviridae of organism Human adenovirus 23

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QUB4_E1B19K-02      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
W8CZB0_E1B19K-02      MEPEHPTEQGLHSGLRSHAPVEGLGQAAGTENLELLASTASSSGSSSSTQ
M0QUB4_E1B19K-01      --------------------------------------------------
W8CZB0_E1B19K-01      --------------------------------------------------
                                                                        

M0QUB4_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTTMAR
W8CZB0_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVASLYPELSKVLTTMAR
M0QUB4_E1B19K-01      -------------------------------MDVWTILADFSK-----TR
W8CZB0_E1B19K-01      -------------------------------MEVWTILGDFNK-----TR
                                                      :* ::  ::.*     :*

M0QUB4_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
W8CZB0_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
M0QUB4_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
W8CZB0_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
                       :  : *** .                                 *: . .

M0QUB4_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYIS
W8CZB0_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYIS
M0QUB4_E1B19K-01      FGTPLSRLVY-TVKKDYKEEFEN-----LFADCS-GLLDSLNLGHQS---
W8CZB0_E1B19K-01      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNFGHQS---
                      :*    .  : . .:*::* :::     * .**.  : .::*: * .   

M0QUB4_E1B19K-02      GNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
W8CZB0_E1B19K-02      GNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
M0QUB4_E1B19K-01      --------------------------LFQERVLHSLDFSSPGRTTAGVAF
W8CZB0_E1B19K-01      --------------------------LFQERVLHSLDFSSPGRTTAGVAF
                                                ::: . :  :::.  * .  ** *

M0QUB4_E1B19K-02      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
W8CZB0_E1B19K-02      MT------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
M0QUB4_E1B19K-01      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWL----
W8CZB0_E1B19K-01      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWL----
                      :.      ..   *    ::.*  *   :* *  . ** .: . *:    

M0QUB4_E1B19K-02      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKH
W8CZB0_E1B19K-02      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKH
M0QUB4_E1B19K-01      -----------------LQPAAPGLLRLHRQTSM----------------
W8CZB0_E1B19K-01      -----------------LQPAAPGLLRLHRQTSM----------------
                                       *  :: *  *:.. :*:                

M0QUB4_E1B19K-02      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCH
W8CZB0_E1B19K-02      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCH
M0QUB4_E1B19K-01      --------------------------------------------------
W8CZB0_E1B19K-01      --------------------------------------------------
                                                                        

M0QUB4_E1B19K-02      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
W8CZB0_E1B19K-02      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
M0QUB4_E1B19K-01      --------------------------------------------------
W8CZB0_E1B19K-01      --------------------------------------------------
                                                                        

M0QUB4_E1B19K-02      DETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
W8CZB0_E1B19K-02      DETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
M0QUB4_E1B19K-01      -------------------------LEEEMRQAMDENPRSGLD-PPSEEE
W8CZB0_E1B19K-01      -------------------------LEEEMRQAMDENPRSGLD-PPSEEE
                                               : **:*      . :* : ..* *:

M0QUB4_E1B19K-02      TD
W8CZB0_E1B19K-02      TD
M0QUB4_E1B19K-01      LD
W8CZB0_E1B19K-01      LD
                       *

© 1998-2022Legal notice