Dataset for protein E1B 19K of organism Human adenovirus 21a

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A075IQ70_E1B19K-      --------------------MEVWAILEDLKQTRLLLENAS---------
A0A075IQ70_E1B19K-      MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
                                            :*     :* .: *** . **         

A0A075IQ70_E1B19K-      ------------------------DGVSGFWR------------------
A0A075IQ70_E1B19K-      TGHASGSGGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTSSGQDRGI
                                                .**:.::                   

A0A075IQ70_E1B19K-      ----------------------------FWFG------------------
A0A075IQ70_E1B19K-      KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
                                                    :*.                   

A0A075IQ70_E1B19K-      ------------------GDLARLVFRIKQDYR---------------EE
A0A075IQ70_E1B19K-      EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
                                           : *.: :* .::**               : 

A0A075IQ70_E1B19K-      FEKLLDDS-------------PGLFEA-----LNLGHQAHFKEKVLSVLD
A0A075IQ70_E1B19K-      AEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMAN
                         * ::* .             **:.       :*: .:.   : :: : :

A0A075IQ70_E1B19K-      FSTPGRTAAAVAFLTFILDKW----IRQTHFSKGYVLD------------
A0A075IQ70_E1B19K-      TKLILHGCSLFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
                         .   . .: ..* .  :: *    :*   *   ::              

A0A075IQ70_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSNER
                                                                          

A0A075IQ70_E1B19K-      ------------------FIAAALWRTW----------------------
A0A075IQ70_E1B19K-      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
                                          .*.:  ...*                      

A0A075IQ70_E1B19K-      -----KARRMRTILDYWPVQPLGVAGILRHPPAMPAVLEEEQQEDNPRA-
A0A075IQ70_E1B19K-      MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRAC
                             : ..:..:*:  ... :.::**:     :  :*  :: : . ** 

A0A075IQ70_E1B19K-      ----------------------------------GLDPPVEE
A0A075IQ70_E1B19K-      ECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
                                                          * .    :

© 1998-2020Legal notice