Dataset for protein E1B 19K of organism Human adenovirus 20

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QU76_E1B19K-01      --------------------------------------------------
M0QU76_E1B19K-02      MEPEHPTEQGLHSGLRSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQ
                                                                        

M0QU76_E1B19K-01      -------------------------------MDVWTILADFSK-----TR
M0QU76_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
                                                      :* :: .::**     :*

M0QU76_E1B19K-01      RLVEDSSDGCS---------------------------------GFWRHW
M0QU76_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDK
                       :  : *** .                                 *: . .

M0QU76_E1B19K-01      FGTPLSRLVY-TVKKDYNEEIEN-----LFADCSGLL-DSLNLGHQSLFQ
M0QU76_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
                      :*    .  : . .:*::* *::     * .**. :: .::*: * . :.

M0QU76_E1B19K-01      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
M0QU76_E1B19K-02      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * *: :**                         :.  * .  ** *

M0QU76_E1B19K-01      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPA
M0QU76_E1B19K-02      MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
                      :.      ..:  *    ::.*  *   :* *  . ** .: . *:   .

M0QU76_E1B19K-01      AP----------------------------------GLLRLHRQTSMLEE
M0QU76_E1B19K-02      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKH
                       *                                  * : * . *: *: 

M0QU76_E1B19K-01      EMRQAMDEN-----------------------------------------
M0QU76_E1B19K-02      NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
                      :* :.  ::                                         

M0QU76_E1B19K-01      -----PRSGLDP--------------------------------------
M0QU76_E1B19K-02      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
                            *. ::*                                      

M0QU76_E1B19K-01      ---------------------------------------------PSEEE
M0QU76_E1B19K-02      DETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
                                                                   .* *:

M0QU76_E1B19K-01      LD
M0QU76_E1B19K-02      TD
                       *

© 1998-2020Legal notice